SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1g5hA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1g5hA
Domain Number 1 Region: 24-313
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.46e-120
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000000319
Further Details:      
 
Domain Number 2 Region: 327-452
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 5.5e-28
Family Anticodon-binding domain of Class II aaRS 0.000000397
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1g5hA   PDB: 1g5h
Sequence length 454
Comment (A:)
Sequence
wlsgyagpadgtqqpdapehavarealvdlcrrrhflsgtpqqlstaallsgcharfgpl
gvelrknlasqwwssmvvfreqvfavdslhqepgssqprdsafrlvspesireilqdrep
skeqlvaflenllktsgklratllhgalehyvncldlvnrklpfglaqigvcfhpvsnsn
qtpssvtrvgekteaslvwftptrtssqwldfwlrhrllwwrkfamspsnfssadcqdel
grkgsklyysfpwgkepietlwnlgdqellhtypgnvstiqgrdgrknvvpcvlsvsgdv
dlgtlaylydsfqlaensfarkkslqrkvlklhpclapikvaldvgkgptvelrqvcqgl
lnellengisvwpgysetvhssleqlhskydemsvlfsvlvtettlengliqlrsrdttm
kemmhisklrdflvkylasasnvaaaldhhhhhh
Download sequence
Identical sequences 1g5h_A 1g5h_B 1g5h_C 1g5h_D 1g5i_A 1g5i_B 1g5i_C 1g5i_D 1g5hA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]