SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1gaqB from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1gaqB
Domain Number 1 Region: 3-95
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 5.45e-46
Family 2Fe-2S ferredoxin-related 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1gaqB   PDB: 1gaq   SUPERFAMILY: 1gaqB
Sequence length 98
Comment (B:)
Sequence
atynvklitpegevelqvpddvyildqaeedgidlpyscragscsscagkvvsgsvdqsd
qsylddgqiadgwvltchayptsdvviethkeeeltga
Download sequence
Identical sequences cath|current|1gaqB00/1-98 cath|current|3b2fA00/1-96 cath|current|3b2fB00/1-96 d1gaqb_ 1gaq_B 3b2f_A 3b2f_B 5h8y_E 5h8y_F 5h92_C 1gaqB

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]