SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1gjjA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1gjjA
Domain Number 1 Region: 2-54
Classification Level Classification E-value
Superfamily LEM domain 1.02e-23
Family LEM domain 0.0000504
Further Details:      
 
Domain Number 2 Region: 106-156
Classification Level Classification E-value
Superfamily LEM domain 8.05e-16
Family LEM domain 0.0000636
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1gjjA   PDB: 1gjj
Sequence length 168
Comment (A:)
Sequence
mpefledpsvltkdklkselvannvtlpageqrkdvyvqlylqhltarnrpplpagtnsk
gppdfssdeereptpvlgsgaaaagrsraavgrkatkktdkprqedkddldvteltnedl
ldqlvkygvnpgpivgttrklyekkllklreqgtesrsstplptisss
Download sequence
Identical sequences 1gjjA 1gjj_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]