SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1gk9A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1gk9A
Domain Number 1 Region: 4-205
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 8.1e-61
Family Penicillin acylase, catalytic domain 0.00000000232
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1gk9A   PDB: 1gk9
Sequence length 260
Comment (A:)
Sequence
eqssseikivrdeygmphiyandtwhlfygygyvvaqdrlfqmemarrstqgtvaevlgk
dfvkfdkdirrnywpdairaqiaalspedmsilqgyadgmnawidkvntnpetllpkqfn
tfgftpkrwepfdvamifvgtmanrfsdstseidnlalltalkdkygvsqgmavfnqlkw
lvnpsapttiavqesnyplkfnqqnsqtaallprydlpapmldrpakgadgallalaagk
nretiaaqfaqgganglagy
Download sequence
Identical sequences 1e3a_A 1gk9_A 1gkf_A 1gk9A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]