SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1gkpA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1gkpA
Domain Number 1 Region: 50-393
Classification Level Classification E-value
Superfamily Metallo-dependent hydrolases 1.64e-116
Family Hydantoinase (dihydropyrimidinase), catalytic domain 0.00000000000518
Further Details:      
 
Domain Number 2 Region: 2-54,389-455
Classification Level Classification E-value
Superfamily Composite domain of metallo-dependent hydrolases 1.76e-35
Family Hydantoinase (dihydropyrimidinase) 0.0000501
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1gkpA   PDB: 1gkp
Sequence length 458
Comment (A:)
Sequence
PLLIKNGEIITADSRYKADIYAEGETITRIGQNLEAPPGTEVIDATGKYVFPGFIDPHVH
IYLPFMATFAKDTHETGSKAALMGGTTTYIEMCCPSRNDDALEGYQLWKSKAEGNSYCDY
TFHMAVSKFDEKTEGQLREIVADGISSFKIFLSYKNFFGVDDGEMYQTLRLAKELGVIVT
AHCENAELVGRLQQKLLSEGKTGPEWHEPSRPEAVEAEGTARFATFLETTGATGYVVHLS
CKPALDAAMAAKARGVPIYIESVIPHFLLDKTYAERGGVEAMKYIMSPPLRDKRNQKVLW
DALAQGFIDTVGTDHCPFDTEQKLLGKEAFTAIPNGIPAIEDRVNLLYTYGVSRGRLDIH
RFVDAASTKAAKLFGLFPRKGTIAVGSDADLVVYDPQYRGTISVKTQHVNNDYNGFEGFE
IDGRPSVVTVRGKVAVRDGQFVGEKGWGKLLRREPMYF
Download sequence
Identical sequences Q7SIE9
1gkp_A 1gkp_B 1gkp_C 1gkp_D 1gkp_E 1gkp_F 1gkq_A 1gkq_B 1gkq_C 1gkq_D 1gkpA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]