SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1gkrA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1gkrA
Domain Number 1 Region: 80-389
Classification Level Classification E-value
Superfamily Metallo-dependent hydrolases 2.82e-106
Family Hydantoinase (dihydropyrimidinase), catalytic domain 0.0000000000134
Further Details:      
 
Domain Number 2 Region: 1-54,379-450
Classification Level Classification E-value
Superfamily Composite domain of metallo-dependent hydrolases 1.31e-36
Family Hydantoinase (dihydropyrimidinase) 0.0000553
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1gkrA   PDB: 1gkr
Sequence length 458
Comment (A:)
Sequence
MFDVIVKNCRLVSSDGITEADILVKDGKVAAISADTSDVEASRTIDAGGKFVMPGVVDEH
VHIIDMDLKNRYGRFELDSESAAVGGITTIIEMPITFPPTTTLDAFLEKKKQAGQRLKVD
FALYGGGVPGNLPEIRKMHDAGAVGFKSMMAASVPGMFDAVSDGELFEIFQEIAACGSVI
VVHAENETIIQALQKQIKAAGGKDMAAYEASQPVFQENEAIQRALLLQKEAGCRLIVLHV
SNPDGVELIHQAQSEGQDVHCESGPQYLNITTDDAERIGPYMKVAPPVRSAEMNIRLWEQ
LENGLIDTLGSDHGGHPVEDKEPGWKDVWKAGNGALGLETSLPMMLTNGVNKGRLSLERL
VEVMCEKPAKLFGIYPQKGTLQVGSDADLLILDLDIDTKVDASQFRSLHKYSPFDGMPVT
GAPVLTMVRGTVVAEKGEVLVEQGFGQFVTRRNYEASK
Download sequence
Identical sequences P81006
1gkrA 1gkr_A 1gkr_B 1gkr_C 1gkr_D

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]