SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1gl0I from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1gl0I
Domain Number 1 Region: 2-34
Classification Level Classification E-value
Superfamily PMP inhibitors 0.000000000000652
Family PMP inhibitors 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1gl0I   PDB: 1gl0   SUPERFAMILY: 1gl0I
Sequence length 35
Comment (I:)
Sequence
eekctpgqvkqqdcntctctptgvwgctlmgcqpa
Download sequence
Identical sequences 1gl0_I 1gl0I

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]