SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1go5A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1go5A
Domain Number 1 Region: 1-69
Classification Level Classification E-value
Superfamily UBA-like 4.45e-28
Family TAP-C domain-like 0.0000267
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1go5A   PDB: 1go5   SUPERFAMILY: 1go5A
Sequence length 69
Comment (A:)
Sequence
paptpssspvptlspeqqemlqafstqsgmnlewsqkclqdnnwdytrsaqafthlkakg
eipevafmk
Download sequence
Identical sequences 1go5_A cath|current|1go5A00/2-70 d1go5a_ 1go5A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]