SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1gpmA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1gpmA
Domain Number 1 Region: 208-404
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 3.35e-126
Family N-type ATP pyrophosphatases 0.0000389
Further Details:      
 
Domain Number 2 Region: 10-209
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 4.73e-104
Family Class I glutamine amidotransferases (GAT) 0.0000135
Further Details:      
 
Domain Number 3 Region: 405-525
Classification Level Classification E-value
Superfamily GMP synthetase C-terminal dimerisation domain 3.51e-97
Family GMP synthetase C-terminal dimerisation domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1gpmA   PDB: 1gpm
Sequence length 525
Comment (A:)
Sequence
MTENIHKHRILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRDFNPSGIILSGGP
ESTTEENSPRAPQYVFEAGVPVFGVCYGMQTMAMQLGGHVEASNEREFGYAQVEVVNDSA
LVRGIEDALTADGKPLLDVWMSHGDKVTAIPSDFITVASTESCPFAIMANEEKRFYGVQF
HPEVTHTRQGMRMLERFVRDICQCEALWTPAKIIDDAVARIREQVGDDKVILGLSGGVDS
SVTAMLLHRAIGKNLTCVFVDNGLLRLNEAEQVLDMFGDHFGLNIVHVPAEDRFLSALAG
ENDPEAKRKIIGRVFVEVFDEEALKLEDVKWLAQGTIYPDVIESAASATGKAHVIKSHHN
VGGLPKEMKMGLVEPLKELFKDEVRKIGLELGLPYDMLYRHPFPGPGLGVRVLGEVKKEY
CDLLRRADAIFIEELRKADLYDKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDF
MTAHWAHLPYDFLGRVSNRIINEVNGISRVVYDISGKPPATIEWE
Download sequence
Identical sequences A0A024KXM5 A0A037YAB1 A0A062XX96 A0A069XNI3 A0A070SU55 A0A070UYY7 A0A080IUU3 A0A0E0U289 A0A0E1M1Y5 A0A0M7NLK4 A0A125X0E9 A0A140N9Q3 A0A142H5D0 A0A181WNR1 A0A1E2VRL1 A0A1S9JJL5 A0A1X3J2N6 A0A1X3JF32 A0A235JZS5 A0A2A2XI05 B1XAY2 C4ZX82 D6IAD6 D8AEJ7 E3PG51 E9XK39 E9YR24 F4SHV1 F4THI0 G0FFX3 H4UME2 I2RHQ2 I2XD33 P04079 S0Y083 S0YKN8 T6M7S1 T9CUR8 U9YHL2 W1AX04
gi|386615209|ref|YP_006134875.1| 316385.ECDH10B_2673 316407.guaA 413997.ECB_02399 469008.ECBD_1179 511145.b2507 595496.BWG_2271 1gpmA gi|387622207|ref|YP_006129835.1| gi|388478543|ref|YP_490735.1| gi|386705773|ref|YP_006169620.1| gi|170082117|ref|YP_001731437.1| gi|254162481|ref|YP_003045589.1| gi|253772599|ref|YP_003035430.1| gi|387613103|ref|YP_006116219.1| 1gpm_A 1gpm_B 1gpm_C 1gpm_D NYSGXRC-6319b gi|251785832|ref|YP_003000136.1| gi|471334179|ref|YP_007557656.1| gi|16130432|ref|NP_417002.1| NP_417002.1.90541 WP_000138270.1.100085 WP_000138270.1.100111 WP_000138270.1.100285 WP_000138270.1.10034 WP_000138270.1.100441 WP_000138270.1.100451 WP_000138270.1.100487 WP_000138270.1.100496 WP_000138270.1.10051 WP_000138270.1.100531 WP_000138270.1.100614 WP_000138270.1.100753 WP_000138270.1.100824 WP_000138270.1.10086 WP_000138270.1.101033 WP_000138270.1.101158 WP_000138270.1.101186 WP_000138270.1.101282 WP_000138270.1.10131 WP_000138270.1.101423 WP_000138270.1.101439 WP_000138270.1.101654 WP_000138270.1.101737 WP_000138270.1.101747 WP_000138270.1.10187 WP_000138270.1.10188 WP_000138270.1.101908 WP_000138270.1.101962 WP_000138270.1.10235 WP_000138270.1.10304 WP_000138270.1.1040 WP_000138270.1.10417 WP_000138270.1.10491 WP_000138270.1.10496 WP_000138270.1.10569 WP_000138270.1.10833 WP_000138270.1.11047 WP_000138270.1.1113 WP_000138270.1.11241 WP_000138270.1.11436 WP_000138270.1.11467 WP_000138270.1.1168 WP_000138270.1.11844 WP_000138270.1.11955 WP_000138270.1.11982 WP_000138270.1.12060 WP_000138270.1.12230 WP_000138270.1.12352 WP_000138270.1.12415 WP_000138270.1.12458 WP_000138270.1.12542 WP_000138270.1.12558 WP_000138270.1.12582 WP_000138270.1.12646 WP_000138270.1.12675 WP_000138270.1.127 WP_000138270.1.12756 WP_000138270.1.12775 WP_000138270.1.12914 WP_000138270.1.12944 WP_000138270.1.13002 WP_000138270.1.13031 WP_000138270.1.1312 WP_000138270.1.13136 WP_000138270.1.13176 WP_000138270.1.13239 WP_000138270.1.13258 WP_000138270.1.13281 WP_000138270.1.13333 WP_000138270.1.13409 WP_000138270.1.13585 WP_000138270.1.13618 WP_000138270.1.13877 WP_000138270.1.13949 WP_000138270.1.14030 WP_000138270.1.1419 WP_000138270.1.14277 WP_000138270.1.14322 WP_000138270.1.14346 WP_000138270.1.1438 WP_000138270.1.14501 WP_000138270.1.14529 WP_000138270.1.1461 WP_000138270.1.14811 WP_000138270.1.14833 WP_000138270.1.14871 WP_000138270.1.14914 WP_000138270.1.14946 WP_000138270.1.14963 WP_000138270.1.14992 WP_000138270.1.1512 WP_000138270.1.15121 WP_000138270.1.15259 WP_000138270.1.15420 WP_000138270.1.15576 WP_000138270.1.15731 WP_000138270.1.15740 WP_000138270.1.15747 WP_000138270.1.1588 WP_000138270.1.15990 WP_000138270.1.16010 WP_000138270.1.16086 WP_000138270.1.1609 WP_000138270.1.16102 WP_000138270.1.16111 WP_000138270.1.16179 WP_000138270.1.16294 WP_000138270.1.1634 WP_000138270.1.16532 WP_000138270.1.16541 WP_000138270.1.16577 WP_000138270.1.16715 WP_000138270.1.16721 WP_000138270.1.16752 WP_000138270.1.16843 WP_000138270.1.17018 WP_000138270.1.17084 WP_000138270.1.17087 WP_000138270.1.17123 WP_000138270.1.17153 WP_000138270.1.17216 WP_000138270.1.17290 WP_000138270.1.17360 WP_000138270.1.17432 WP_000138270.1.17534 WP_000138270.1.1755 WP_000138270.1.17577 WP_000138270.1.17757 WP_000138270.1.17937 WP_000138270.1.17952 WP_000138270.1.18118 WP_000138270.1.18133 WP_000138270.1.18381 WP_000138270.1.18402 WP_000138270.1.18550 WP_000138270.1.18588 WP_000138270.1.18725 WP_000138270.1.19100 WP_000138270.1.19150 WP_000138270.1.19194 WP_000138270.1.19205 WP_000138270.1.19277 WP_000138270.1.193 WP_000138270.1.19313 WP_000138270.1.19374 WP_000138270.1.1963 WP_000138270.1.19644 WP_000138270.1.19661 WP_000138270.1.19684 WP_000138270.1.1982 WP_000138270.1.19889 WP_000138270.1.19940 WP_000138270.1.19957 WP_000138270.1.19994 WP_000138270.1.20164 WP_000138270.1.20170 WP_000138270.1.20277 WP_000138270.1.20445 WP_000138270.1.20506 WP_000138270.1.20536 WP_000138270.1.2063 WP_000138270.1.20638 WP_000138270.1.20737 WP_000138270.1.20765 WP_000138270.1.20943 WP_000138270.1.20982 WP_000138270.1.2100 WP_000138270.1.21017 WP_000138270.1.21020 WP_000138270.1.21033 WP_000138270.1.21057 WP_000138270.1.21122 WP_000138270.1.21251 WP_000138270.1.2142 WP_000138270.1.21470 WP_000138270.1.2156 WP_000138270.1.21573 WP_000138270.1.21661 WP_000138270.1.21733 WP_000138270.1.21756 WP_000138270.1.21758 WP_000138270.1.21771 WP_000138270.1.21823 WP_000138270.1.21915 WP_000138270.1.21992 WP_000138270.1.22060 WP_000138270.1.22113 WP_000138270.1.22314 WP_000138270.1.22363 WP_000138270.1.22450 WP_000138270.1.22574 WP_000138270.1.22632 WP_000138270.1.22669 WP_000138270.1.22690 WP_000138270.1.22830 WP_000138270.1.22885 WP_000138270.1.2300 WP_000138270.1.23044 WP_000138270.1.23090 WP_000138270.1.23378 WP_000138270.1.23511 WP_000138270.1.23549 WP_000138270.1.23812 WP_000138270.1.23869 WP_000138270.1.23898 WP_000138270.1.23945 WP_000138270.1.24089 WP_000138270.1.24124 WP_000138270.1.24170 WP_000138270.1.2428 WP_000138270.1.24304 WP_000138270.1.24316 WP_000138270.1.24362 WP_000138270.1.24577 WP_000138270.1.24583 WP_000138270.1.24616 WP_000138270.1.24634 WP_000138270.1.24703 WP_000138270.1.24876 WP_000138270.1.24899 WP_000138270.1.24960 WP_000138270.1.25085 WP_000138270.1.25141 WP_000138270.1.25203 WP_000138270.1.25312 WP_000138270.1.25324 WP_000138270.1.25643 WP_000138270.1.25713 WP_000138270.1.25832 WP_000138270.1.25996 WP_000138270.1.26048 WP_000138270.1.26150 WP_000138270.1.26196 WP_000138270.1.26379 WP_000138270.1.26480 WP_000138270.1.26588 WP_000138270.1.26609 WP_000138270.1.27134 WP_000138270.1.27260 WP_000138270.1.27451 WP_000138270.1.27560 WP_000138270.1.27585 WP_000138270.1.27742 WP_000138270.1.27797 WP_000138270.1.27879 WP_000138270.1.27923 WP_000138270.1.27971 WP_000138270.1.28128 WP_000138270.1.28145 WP_000138270.1.28268 WP_000138270.1.28271 WP_000138270.1.28314 WP_000138270.1.28371 WP_000138270.1.28509 WP_000138270.1.28662 WP_000138270.1.28697 WP_000138270.1.28711 WP_000138270.1.28760 WP_000138270.1.28809 WP_000138270.1.28919 WP_000138270.1.28994 WP_000138270.1.29016 WP_000138270.1.29061 WP_000138270.1.29128 WP_000138270.1.29221 WP_000138270.1.29239 WP_000138270.1.2942 WP_000138270.1.29443 WP_000138270.1.2945 WP_000138270.1.29746 WP_000138270.1.2995 WP_000138270.1.29967 WP_000138270.1.30004 WP_000138270.1.30231 WP_000138270.1.30247 WP_000138270.1.30397 WP_000138270.1.30472 WP_000138270.1.30479 WP_000138270.1.30497 WP_000138270.1.30546 WP_000138270.1.30554 WP_000138270.1.30630 WP_000138270.1.30639 WP_000138270.1.30749 WP_000138270.1.30783 WP_000138270.1.31000 WP_000138270.1.31029 WP_000138270.1.31211 WP_000138270.1.31379 WP_000138270.1.31407 WP_000138270.1.31433 WP_000138270.1.31506 WP_000138270.1.31614 WP_000138270.1.3181 WP_000138270.1.31833 WP_000138270.1.31839 WP_000138270.1.31978 WP_000138270.1.32093 WP_000138270.1.32121 WP_000138270.1.32127 WP_000138270.1.32143 WP_000138270.1.32222 WP_000138270.1.32394 WP_000138270.1.32479 WP_000138270.1.32655 WP_000138270.1.32661 WP_000138270.1.32815 WP_000138270.1.32835 WP_000138270.1.32903 WP_000138270.1.32984 WP_000138270.1.33244 WP_000138270.1.33325 WP_000138270.1.334 WP_000138270.1.33408 WP_000138270.1.33422 WP_000138270.1.33424 WP_000138270.1.33476 WP_000138270.1.33502 WP_000138270.1.33525 WP_000138270.1.33526 WP_000138270.1.33565 WP_000138270.1.33648 WP_000138270.1.33736 WP_000138270.1.33746 WP_000138270.1.33879 WP_000138270.1.33896 WP_000138270.1.33952 WP_000138270.1.3401 WP_000138270.1.34124 WP_000138270.1.34277 WP_000138270.1.34332 WP_000138270.1.34363 WP_000138270.1.34525 WP_000138270.1.34532 WP_000138270.1.34538 WP_000138270.1.347 WP_000138270.1.34727 WP_000138270.1.34990 WP_000138270.1.34993 WP_000138270.1.3515 WP_000138270.1.35204 WP_000138270.1.35211 WP_000138270.1.35360 WP_000138270.1.35704 WP_000138270.1.35724 WP_000138270.1.35904 WP_000138270.1.36164 WP_000138270.1.36334 WP_000138270.1.36627 WP_000138270.1.36724 WP_000138270.1.36739 WP_000138270.1.36746 WP_000138270.1.36747 WP_000138270.1.36833 WP_000138270.1.37057 WP_000138270.1.37122 WP_000138270.1.3723 WP_000138270.1.37233 WP_000138270.1.37261 WP_000138270.1.37433 WP_000138270.1.37445 WP_000138270.1.37485 WP_000138270.1.37576 WP_000138270.1.37588 WP_000138270.1.37750 WP_000138270.1.37897 WP_000138270.1.3796 WP_000138270.1.37964 WP_000138270.1.38085 WP_000138270.1.38105 WP_000138270.1.3811 WP_000138270.1.3815 WP_000138270.1.38155 WP_000138270.1.38182 WP_000138270.1.38323 WP_000138270.1.38371 WP_000138270.1.38485 WP_000138270.1.38636 WP_000138270.1.38956 WP_000138270.1.39164 WP_000138270.1.39167 WP_000138270.1.39356 WP_000138270.1.39365 WP_000138270.1.39367 WP_000138270.1.39430 WP_000138270.1.39594 WP_000138270.1.39626 WP_000138270.1.39829 WP_000138270.1.39870 WP_000138270.1.39938 WP_000138270.1.39961 WP_000138270.1.39966 WP_000138270.1.39970 WP_000138270.1.40 WP_000138270.1.40140 WP_000138270.1.40192 WP_000138270.1.40212 WP_000138270.1.40218 WP_000138270.1.40317 WP_000138270.1.40389 WP_000138270.1.40445 WP_000138270.1.40499 WP_000138270.1.40524 WP_000138270.1.40548 WP_000138270.1.406 WP_000138270.1.40712 WP_000138270.1.40815 WP_000138270.1.40898 WP_000138270.1.40912 WP_000138270.1.40937 WP_000138270.1.40965 WP_000138270.1.41206 WP_000138270.1.4126 WP_000138270.1.41363 WP_000138270.1.41401 WP_000138270.1.41436 WP_000138270.1.41481 WP_000138270.1.41484 WP_000138270.1.41530 WP_000138270.1.41556 WP_000138270.1.41782 WP_000138270.1.41813 WP_000138270.1.41900 WP_000138270.1.41960 WP_000138270.1.42022 WP_000138270.1.42033 WP_000138270.1.42073 WP_000138270.1.42113 WP_000138270.1.42209 WP_000138270.1.42214 WP_000138270.1.42376 WP_000138270.1.4242 WP_000138270.1.42432 WP_000138270.1.42547 WP_000138270.1.42632 WP_000138270.1.42770 WP_000138270.1.4282 WP_000138270.1.42879 WP_000138270.1.42936 WP_000138270.1.43035 WP_000138270.1.4306 WP_000138270.1.43174 WP_000138270.1.43216 WP_000138270.1.43270 WP_000138270.1.43489 WP_000138270.1.43918 WP_000138270.1.44088 WP_000138270.1.44096 WP_000138270.1.44100 WP_000138270.1.44115 WP_000138270.1.44130 WP_000138270.1.44162 WP_000138270.1.44166 WP_000138270.1.44365 WP_000138270.1.44422 WP_000138270.1.44458 WP_000138270.1.44558 WP_000138270.1.44724 WP_000138270.1.44759 WP_000138270.1.44821 WP_000138270.1.44849 WP_000138270.1.44854 WP_000138270.1.44923 WP_000138270.1.44970 WP_000138270.1.44980 WP_000138270.1.45028 WP_000138270.1.45043 WP_000138270.1.4516 WP_000138270.1.45246 WP_000138270.1.45329 WP_000138270.1.45440 WP_000138270.1.45581 WP_000138270.1.45595 WP_000138270.1.4574 WP_000138270.1.45741 WP_000138270.1.4593 WP_000138270.1.45931 WP_000138270.1.45933 WP_000138270.1.46026 WP_000138270.1.46115 WP_000138270.1.46186 WP_000138270.1.46213 WP_000138270.1.46325 WP_000138270.1.46329 WP_000138270.1.46441 WP_000138270.1.4647 WP_000138270.1.46573 WP_000138270.1.46582 WP_000138270.1.46802 WP_000138270.1.46820 WP_000138270.1.46909 WP_000138270.1.46932 WP_000138270.1.46991 WP_000138270.1.47038 WP_000138270.1.47048 WP_000138270.1.47156 WP_000138270.1.47224 WP_000138270.1.47344 WP_000138270.1.47401 WP_000138270.1.47414 WP_000138270.1.47496 WP_000138270.1.47634 WP_000138270.1.47646 WP_000138270.1.47673 WP_000138270.1.4772 WP_000138270.1.47734 WP_000138270.1.47740 WP_000138270.1.47764 WP_000138270.1.47765 WP_000138270.1.47791 WP_000138270.1.48048 WP_000138270.1.48096 WP_000138270.1.48111 WP_000138270.1.48194 WP_000138270.1.48290 WP_000138270.1.48353 WP_000138270.1.48371 WP_000138270.1.486 WP_000138270.1.4871 WP_000138270.1.48847 WP_000138270.1.48860 WP_000138270.1.48910 WP_000138270.1.48953 WP_000138270.1.48974 WP_000138270.1.49009 WP_000138270.1.49531 WP_000138270.1.49537 WP_000138270.1.49645 WP_000138270.1.49661 WP_000138270.1.497 WP_000138270.1.49733 WP_000138270.1.49768 WP_000138270.1.49900 WP_000138270.1.50006 WP_000138270.1.50078 WP_000138270.1.5017 WP_000138270.1.50278 WP_000138270.1.50452 WP_000138270.1.50579 WP_000138270.1.5067 WP_000138270.1.51042 WP_000138270.1.5106 WP_000138270.1.51172 WP_000138270.1.51283 WP_000138270.1.51325 WP_000138270.1.51380 WP_000138270.1.51441 WP_000138270.1.5146 WP_000138270.1.51495 WP_000138270.1.51548 WP_000138270.1.51552 WP_000138270.1.5158 WP_000138270.1.51587 WP_000138270.1.51607 WP_000138270.1.51760 WP_000138270.1.51784 WP_000138270.1.51881 WP_000138270.1.51968 WP_000138270.1.52002 WP_000138270.1.52020 WP_000138270.1.52076 WP_000138270.1.52127 WP_000138270.1.52137 WP_000138270.1.52186 WP_000138270.1.52211 WP_000138270.1.52214 WP_000138270.1.52243 WP_000138270.1.52305 WP_000138270.1.52399 WP_000138270.1.52421 WP_000138270.1.52492 WP_000138270.1.52544 WP_000138270.1.52558 WP_000138270.1.5265 WP_000138270.1.52780 WP_000138270.1.52844 WP_000138270.1.52853 WP_000138270.1.52895 WP_000138270.1.53012 WP_000138270.1.53020 WP_000138270.1.53110 WP_000138270.1.53327 WP_000138270.1.53377 WP_000138270.1.53428 WP_000138270.1.53594 WP_000138270.1.53693 WP_000138270.1.53769 WP_000138270.1.53810 WP_000138270.1.53884 WP_000138270.1.5393 WP_000138270.1.53931 WP_000138270.1.53972 WP_000138270.1.53994 WP_000138270.1.54329 WP_000138270.1.54344 WP_000138270.1.54463 WP_000138270.1.54476 WP_000138270.1.54507 WP_000138270.1.54602 WP_000138270.1.54605 WP_000138270.1.5461 WP_000138270.1.54617 WP_000138270.1.54620 WP_000138270.1.5470 WP_000138270.1.54981 WP_000138270.1.55003 WP_000138270.1.55005 WP_000138270.1.55112 WP_000138270.1.5512 WP_000138270.1.55123 WP_000138270.1.55203 WP_000138270.1.55359 WP_000138270.1.55425 WP_000138270.1.55472 WP_000138270.1.55529 WP_000138270.1.55551 WP_000138270.1.55556 WP_000138270.1.55571 WP_000138270.1.55574 WP_000138270.1.55629 WP_000138270.1.55720 WP_000138270.1.55825 WP_000138270.1.55868 WP_000138270.1.5614 WP_000138270.1.56164 WP_000138270.1.56197 WP_000138270.1.562 WP_000138270.1.56285 WP_000138270.1.56502 WP_000138270.1.56786 WP_000138270.1.56846 WP_000138270.1.56932 WP_000138270.1.56934 WP_000138270.1.56978 WP_000138270.1.57181 WP_000138270.1.57185 WP_000138270.1.57266 WP_000138270.1.57401 WP_000138270.1.57403 WP_000138270.1.57410 WP_000138270.1.57414 WP_000138270.1.57432 WP_000138270.1.57492 WP_000138270.1.57517 WP_000138270.1.57846 WP_000138270.1.5786 WP_000138270.1.57904 WP_000138270.1.58060 WP_000138270.1.58080 WP_000138270.1.58232 WP_000138270.1.58244 WP_000138270.1.58384 WP_000138270.1.58401 WP_000138270.1.5842 WP_000138270.1.58420 WP_000138270.1.58429 WP_000138270.1.58440 WP_000138270.1.58692 WP_000138270.1.58837 WP_000138270.1.58867 WP_000138270.1.58940 WP_000138270.1.58951 WP_000138270.1.58958 WP_000138270.1.58976 WP_000138270.1.59024 WP_000138270.1.59026 WP_000138270.1.59047 WP_000138270.1.59306 WP_000138270.1.59407 WP_000138270.1.59513 WP_000138270.1.59590 WP_000138270.1.59611 WP_000138270.1.59615 WP_000138270.1.5965 WP_000138270.1.59791 WP_000138270.1.59912 WP_000138270.1.59980 WP_000138270.1.59998 WP_000138270.1.6002 WP_000138270.1.60031 WP_000138270.1.60343 WP_000138270.1.60411 WP_000138270.1.60477 WP_000138270.1.60498 WP_000138270.1.60550 WP_000138270.1.60576 WP_000138270.1.6061 WP_000138270.1.6066 WP_000138270.1.60717 WP_000138270.1.60764 WP_000138270.1.60895 WP_000138270.1.60901 WP_000138270.1.61005 WP_000138270.1.6106 WP_000138270.1.61096 WP_000138270.1.61102 WP_000138270.1.61170 WP_000138270.1.61241 WP_000138270.1.61505 WP_000138270.1.61517 WP_000138270.1.61663 WP_000138270.1.61779 WP_000138270.1.61822 WP_000138270.1.61858 WP_000138270.1.61949 WP_000138270.1.62099 WP_000138270.1.62207 WP_000138270.1.62322 WP_000138270.1.62481 WP_000138270.1.62503 WP_000138270.1.62612 WP_000138270.1.62735 WP_000138270.1.62750 WP_000138270.1.62787 WP_000138270.1.62812 WP_000138270.1.62840 WP_000138270.1.62919 WP_000138270.1.63078 WP_000138270.1.63113 WP_000138270.1.63167 WP_000138270.1.63246 WP_000138270.1.63330 WP_000138270.1.6337 WP_000138270.1.63453 WP_000138270.1.63478 WP_000138270.1.6348 WP_000138270.1.64040 WP_000138270.1.64080 WP_000138270.1.64138 WP_000138270.1.6416 WP_000138270.1.64285 WP_000138270.1.64448 WP_000138270.1.647 WP_000138270.1.64749 WP_000138270.1.64784 WP_000138270.1.64789 WP_000138270.1.65040 WP_000138270.1.65271 WP_000138270.1.65353 WP_000138270.1.65364 WP_000138270.1.65366 WP_000138270.1.65596 WP_000138270.1.65749 WP_000138270.1.65961 WP_000138270.1.65991 WP_000138270.1.66050 WP_000138270.1.66104 WP_000138270.1.66105 WP_000138270.1.66251 WP_000138270.1.66280 WP_000138270.1.66327 WP_000138270.1.6635 WP_000138270.1.66387 WP_000138270.1.66389 WP_000138270.1.66395 WP_000138270.1.66501 WP_000138270.1.6654 WP_000138270.1.66559 WP_000138270.1.66624 WP_000138270.1.6665 WP_000138270.1.66667 WP_000138270.1.66700 WP_000138270.1.66795 WP_000138270.1.66933 WP_000138270.1.67022 WP_000138270.1.67200 WP_000138270.1.67210 WP_000138270.1.67293 WP_000138270.1.67415 WP_000138270.1.67456 WP_000138270.1.67468 WP_000138270.1.67538 WP_000138270.1.67553 WP_000138270.1.67732 WP_000138270.1.67758 WP_000138270.1.67786 WP_000138270.1.67787 WP_000138270.1.67853 WP_000138270.1.67861 WP_000138270.1.68008 WP_000138270.1.6803 WP_000138270.1.68071 WP_000138270.1.6814 WP_000138270.1.68170 WP_000138270.1.68215 WP_000138270.1.68341 WP_000138270.1.68534 WP_000138270.1.68697 WP_000138270.1.68711 WP_000138270.1.68797 WP_000138270.1.68865 WP_000138270.1.68873 WP_000138270.1.68989 WP_000138270.1.69127 WP_000138270.1.6916 WP_000138270.1.69247 WP_000138270.1.69261 WP_000138270.1.69303 WP_000138270.1.69305 WP_000138270.1.6945 WP_000138270.1.69473 WP_000138270.1.69569 WP_000138270.1.69646 WP_000138270.1.69655 WP_000138270.1.69803 WP_000138270.1.69872 WP_000138270.1.70407 WP_000138270.1.70619 WP_000138270.1.70767 WP_000138270.1.70794 WP_000138270.1.70880 WP_000138270.1.7102 WP_000138270.1.71024 WP_000138270.1.71159 WP_000138270.1.71199 WP_000138270.1.71272 WP_000138270.1.71312 WP_000138270.1.71323 WP_000138270.1.71397 WP_000138270.1.71403 WP_000138270.1.71480 WP_000138270.1.71632 WP_000138270.1.71690 WP_000138270.1.71712 WP_000138270.1.71783 WP_000138270.1.71837 WP_000138270.1.71912 WP_000138270.1.71938 WP_000138270.1.71975 WP_000138270.1.71993 WP_000138270.1.71995 WP_000138270.1.72033 WP_000138270.1.7210 WP_000138270.1.72157 WP_000138270.1.72184 WP_000138270.1.72279 WP_000138270.1.72337 WP_000138270.1.72397 WP_000138270.1.72431 WP_000138270.1.72485 WP_000138270.1.72511 WP_000138270.1.72537 WP_000138270.1.72747 WP_000138270.1.72857 WP_000138270.1.72860 WP_000138270.1.72910 WP_000138270.1.73085 WP_000138270.1.73217 WP_000138270.1.73243 WP_000138270.1.73295 WP_000138270.1.73385 WP_000138270.1.73524 WP_000138270.1.73565 WP_000138270.1.73604 WP_000138270.1.73717 WP_000138270.1.73835 WP_000138270.1.73843 WP_000138270.1.73844 WP_000138270.1.73859 WP_000138270.1.73942 WP_000138270.1.7411 WP_000138270.1.74123 WP_000138270.1.74309 WP_000138270.1.74365 WP_000138270.1.74445 WP_000138270.1.74520 WP_000138270.1.74528 WP_000138270.1.74574 WP_000138270.1.7461 WP_000138270.1.74625 WP_000138270.1.74691 WP_000138270.1.74713 WP_000138270.1.7475 WP_000138270.1.74998 WP_000138270.1.75139 WP_000138270.1.75145 WP_000138270.1.75149 WP_000138270.1.75243 WP_000138270.1.75428 WP_000138270.1.75491 WP_000138270.1.75537 WP_000138270.1.75612 WP_000138270.1.75644 WP_000138270.1.75679 WP_000138270.1.75687 WP_000138270.1.75995 WP_000138270.1.76196 WP_000138270.1.76312 WP_000138270.1.76361 WP_000138270.1.76446 WP_000138270.1.76462 WP_000138270.1.76701 WP_000138270.1.76707 WP_000138270.1.76712 WP_000138270.1.76815 WP_000138270.1.76909 WP_000138270.1.76948 WP_000138270.1.77214 WP_000138270.1.77253 WP_000138270.1.77291 WP_000138270.1.77326 WP_000138270.1.77358 WP_000138270.1.77419 WP_000138270.1.77471 WP_000138270.1.77595 WP_000138270.1.77636 WP_000138270.1.77648 WP_000138270.1.77657 WP_000138270.1.77876 WP_000138270.1.77950 WP_000138270.1.78000 WP_000138270.1.78007 WP_000138270.1.78089 WP_000138270.1.78101 WP_000138270.1.78188 WP_000138270.1.78196 WP_000138270.1.78297 WP_000138270.1.78321 WP_000138270.1.78413 WP_000138270.1.78583 WP_000138270.1.78612 WP_000138270.1.78706 WP_000138270.1.78750 WP_000138270.1.78791 WP_000138270.1.78953 WP_000138270.1.7896 WP_000138270.1.79004 WP_000138270.1.79086 WP_000138270.1.79137 WP_000138270.1.79306 WP_000138270.1.79312 WP_000138270.1.79558 WP_000138270.1.79685 WP_000138270.1.79764 WP_000138270.1.79840 WP_000138270.1.7985 WP_000138270.1.7987 WP_000138270.1.79871 WP_000138270.1.80060 WP_000138270.1.80136 WP_000138270.1.80255 WP_000138270.1.80320 WP_000138270.1.80343 WP_000138270.1.80428 WP_000138270.1.80440 WP_000138270.1.80517 WP_000138270.1.80524 WP_000138270.1.8057 WP_000138270.1.80612 WP_000138270.1.80662 WP_000138270.1.80804 WP_000138270.1.80884 WP_000138270.1.8090 WP_000138270.1.81034 WP_000138270.1.81054 WP_000138270.1.81156 WP_000138270.1.81286 WP_000138270.1.81313 WP_000138270.1.81576 WP_000138270.1.81577 WP_000138270.1.81589 WP_000138270.1.81618 WP_000138270.1.81624 WP_000138270.1.81715 WP_000138270.1.81723 WP_000138270.1.81806 WP_000138270.1.81832 WP_000138270.1.81939 WP_000138270.1.82275 WP_000138270.1.82316 WP_000138270.1.8235 WP_000138270.1.82647 WP_000138270.1.82682 WP_000138270.1.82700 WP_000138270.1.82715 WP_000138270.1.82754 WP_000138270.1.82853 WP_000138270.1.82901 WP_000138270.1.8295 WP_000138270.1.83020 WP_000138270.1.8308 WP_000138270.1.831 WP_000138270.1.83140 WP_000138270.1.83205 WP_000138270.1.83224 WP_000138270.1.83238 WP_000138270.1.8345 WP_000138270.1.83537 WP_000138270.1.83735 WP_000138270.1.83941 WP_000138270.1.8411 WP_000138270.1.84331 WP_000138270.1.84339 WP_000138270.1.84405 WP_000138270.1.84410 WP_000138270.1.8444 WP_000138270.1.84534 WP_000138270.1.84584 WP_000138270.1.84738 WP_000138270.1.84740 WP_000138270.1.84875 WP_000138270.1.84877 WP_000138270.1.84948 WP_000138270.1.84966 WP_000138270.1.84977 WP_000138270.1.84989 WP_000138270.1.84994 WP_000138270.1.85002 WP_000138270.1.85216 WP_000138270.1.85247 WP_000138270.1.85255 WP_000138270.1.85260 WP_000138270.1.85310 WP_000138270.1.85336 WP_000138270.1.85500 WP_000138270.1.85621 WP_000138270.1.85752 WP_000138270.1.85857 WP_000138270.1.8592 WP_000138270.1.85948 WP_000138270.1.86001 WP_000138270.1.86016 WP_000138270.1.8621 WP_000138270.1.86294 WP_000138270.1.86412 WP_000138270.1.86452 WP_000138270.1.86461 WP_000138270.1.86475 WP_000138270.1.86609 WP_000138270.1.86681 WP_000138270.1.86691 WP_000138270.1.86731 WP_000138270.1.86753 WP_000138270.1.86787 WP_000138270.1.86848 WP_000138270.1.86959 WP_000138270.1.86997 WP_000138270.1.87389 WP_000138270.1.87491 WP_000138270.1.87563 WP_000138270.1.87574 WP_000138270.1.87610 WP_000138270.1.87655 WP_000138270.1.87721 WP_000138270.1.87914 WP_000138270.1.87919 WP_000138270.1.88017 WP_000138270.1.88110 WP_000138270.1.88263 WP_000138270.1.88301 WP_000138270.1.88304 WP_000138270.1.88434 WP_000138270.1.88467 WP_000138270.1.88607 WP_000138270.1.88710 WP_000138270.1.88711 WP_000138270.1.88729 WP_000138270.1.8873 WP_000138270.1.88757 WP_000138270.1.8879 WP_000138270.1.88834 WP_000138270.1.89069 WP_000138270.1.89099 WP_000138270.1.89255 WP_000138270.1.89416 WP_000138270.1.89458 WP_000138270.1.89468 WP_000138270.1.89471 WP_000138270.1.89674 WP_000138270.1.89679 WP_000138270.1.89700 WP_000138270.1.89899 WP_000138270.1.89923 WP_000138270.1.89977 WP_000138270.1.90017 WP_000138270.1.90078 WP_000138270.1.90358 WP_000138270.1.9036 WP_000138270.1.90449 WP_000138270.1.90511 WP_000138270.1.90520 WP_000138270.1.90536 WP_000138270.1.90799 WP_000138270.1.90828 WP_000138270.1.90951 WP_000138270.1.91170 WP_000138270.1.91277 WP_000138270.1.91340 WP_000138270.1.91341 WP_000138270.1.91462 WP_000138270.1.91551 WP_000138270.1.9169 WP_000138270.1.91850 WP_000138270.1.91994 WP_000138270.1.92005 WP_000138270.1.9215 WP_000138270.1.92161 WP_000138270.1.92361 WP_000138270.1.92496 WP_000138270.1.92568 WP_000138270.1.92614 WP_000138270.1.92615 WP_000138270.1.9264 WP_000138270.1.92708 WP_000138270.1.92742 WP_000138270.1.92792 WP_000138270.1.92845 WP_000138270.1.92865 WP_000138270.1.92943 WP_000138270.1.93019 WP_000138270.1.93048 WP_000138270.1.93054 WP_000138270.1.93175 WP_000138270.1.93276 WP_000138270.1.93312 WP_000138270.1.93629 WP_000138270.1.93652 WP_000138270.1.93673 WP_000138270.1.93755 WP_000138270.1.93768 WP_000138270.1.93911 WP_000138270.1.93939 WP_000138270.1.93971 WP_000138270.1.94025 WP_000138270.1.94057 WP_000138270.1.94176 WP_000138270.1.94271 WP_000138270.1.94367 WP_000138270.1.94388 WP_000138270.1.94436 WP_000138270.1.94445 WP_000138270.1.9457 WP_000138270.1.94738 WP_000138270.1.948 WP_000138270.1.9489 WP_000138270.1.94898 WP_000138270.1.94938 WP_000138270.1.94949 WP_000138270.1.94993 WP_000138270.1.95037 WP_000138270.1.95332 WP_000138270.1.95395 WP_000138270.1.95595 WP_000138270.1.95827 WP_000138270.1.95849 WP_000138270.1.95861 WP_000138270.1.95919 WP_000138270.1.95932 WP_000138270.1.96215 WP_000138270.1.96279 WP_000138270.1.96299 WP_000138270.1.96303 WP_000138270.1.96339 WP_000138270.1.96417 WP_000138270.1.96479 WP_000138270.1.96650 WP_000138270.1.9668 WP_000138270.1.96695 WP_000138270.1.96984 WP_000138270.1.97011 WP_000138270.1.97119 WP_000138270.1.97123 WP_000138270.1.9723 WP_000138270.1.97247 WP_000138270.1.97269 WP_000138270.1.97418 WP_000138270.1.97439 WP_000138270.1.97560 WP_000138270.1.97619 WP_000138270.1.97667 WP_000138270.1.97930 WP_000138270.1.98220 WP_000138270.1.98235 WP_000138270.1.98241 WP_000138270.1.98294 WP_000138270.1.98355 WP_000138270.1.98424 WP_000138270.1.98442 WP_000138270.1.98477 WP_000138270.1.98578 WP_000138270.1.98614 WP_000138270.1.98628 WP_000138270.1.9864 WP_000138270.1.98776 WP_000138270.1.99265 WP_000138270.1.99319 WP_000138270.1.99349 WP_000138270.1.99392 WP_000138270.1.99400 WP_000138270.1.99453 WP_000138270.1.99602 WP_000138270.1.99603 gi|238901672|ref|YP_002927468.1| gi|387622207|ref|YP_006129835.1| gi|251785832|ref|YP_003000136.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]