SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1gpuA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1gpuA
Domain Number 1 Region: 11-333
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.25e-214
Family TK-like PP module 0.00000126
Further Details:      
 
Domain Number 2 Region: 338-532
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 5.7e-114
Family TK-like Pyr module 0.00024
Further Details:      
 
Domain Number 3 Region: 544-668
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 1.46e-52
Family Transketolase C-terminal domain-like 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1gpuA   PDB: 1gpu
Sequence length 680
Comment (A:)
Sequence
MTQFTDIDKLAVSTIRILAVDTVSKANSGHPGAPLGMAPAAHVLWSQMRMNPTNPDWINR
DRFVLSNGHAVALLYSMLHLTGYDLSIEDLKQFRQLGSRTPGHPEFELPGVEVTTGPLGQ
GISNAVGMAMAQANLAATYNKPGFTLSDNYTYVFLGDGCLQEGISSEASSLAGHLKLGNL
IAIYDDNKITIDGATSISFDEDVAKRYEAYGWEVLYVENGNEDLAGIAKAIAQAKLSKDK
PTLIKMTTTIGYGSLHAGSHSVHGAPLKADDVKQLKSKFGFNPDKSFVVPQEVYDHYQKT
ILKPGVEANNKWNKLFSEYQKKFPELGAELARRLSGQLPANWESKLPTYTAKDSAVATRK
LSETVLEDVYNQLPELIGGSADLTPSNLTRWKEALDFQPPSSGSGNYSGRYIRYGIREHA
MGAIMNGISAFGANYKPYGGTFLNFVSYAAGAVRLSALSGHPVIWVATHDSIGVGEDGPT
HQPIETLAHFRSLPNIQVWRPADGNEVSAAYKNSLESKHTPSIIALSRQNLPQLEGSSIE
SASKGGYVLQDVANPDIILVATGSEVSLSVEAAKTLAAKNIKARVVSLPDFFTFDKQPLE
YRLSVLPDNVPIMSVEVLATTCWGKYAHQSFGIDRFGASGKAPEVFKFFGFTPEGVAERA
QKTIAFYKGDKLISPLKKAF
Download sequence
Identical sequences A0A0L8VG37 A6ZWW1 C7GY00 E7KIQ8 E7M1R1 G2WPP6 N1NXM0 P23254
YPR074C YPR074C YPR074C YPR074C 4932.YPR074C tr|A6ZWW1|A6ZWW1_YEAS7 YPR074C YPR074C YPR074C YPR074c___KOG0523 1gpu_A 1gpu_B 1ngs_A 1ngs_B 1trk_A 1trk_B YPR074C NP_015399.1.97178 1gpuA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]