SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1gpxA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1gpxA
Domain Number 1 Region: 2-103
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 5.55e-47
Family 2Fe-2S ferredoxin-related 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1gpxA   PDB: 1gpx   SUPERFAMILY: 1gpxA
Sequence length 106
Comment (A:)
Sequence
skvvyvshdgtrreldvadgvslmqaavsngiydivgdcggsascatchvyvneaftdkv
paanereigmlecvtaelkpnsrlscqiimtpeldgivvdvpdrqw
Download sequence
Identical sequences 000071938|e1gpxA1|221.1.1.12|A:1-106 cath|current|1gpxA00/1-106 d1gpxa_ 1gpxA 1gpx_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]