SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1guuA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1guuA
Domain Number 1 Region: 3-51
Classification Level Classification E-value
Superfamily Homeodomain-like 1.1e-29
Family Myb/SANT domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1guuA   PDB: 1guu   SUPERFAMILY: 1guuA
Sequence length 52
Comment (A:)
Sequence
lgktrwtreedeklkklveqngtddwkvianylpnrtdvqcqhrwqkvlnpe
Download sequence
Identical sequences 000045281|e1mbfA1|101.1.1.42|A:1-52 000045282|e1mbeA1|101.1.1.42|A:1-52 cath|current|1guuA00/40-89 d1mbea_ d1mbfa_ 1guuA 1guu_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]