SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1gv2A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1gv2A
Domain Number 1 Region: 2-97
Classification Level Classification E-value
Superfamily Homeodomain-like 4.64e-34
Family Myb/SANT domain 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1gv2A   PDB: 1gv2
Sequence length 105
Comment (A:)
Sequence
elikgpwtkeedqrviklvqkygpkrwsviakhlkgrigkqcrerwhnhlnpevkktswt
eeedriiyqahkrlgnrwaeiakllpgrtdnaiknhwnstmrrkv
Download sequence
Identical sequences 1gv2_A 1gv2A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]