SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1gx1A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1gx1A
Domain Number 1 Region: 2-157
Classification Level Classification E-value
Superfamily IpsF-like 4.76e-116
Family IpsF-like 0.0000874
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1gx1A   PDB: 1gx1   SUPERFAMILY: 1gx1A
Sequence length 160
Comment (A:)
Sequence
emrighgfdvhafggegpiiiggvripyekgllahsdgdvalhaltdallgaaalgdigk
lfpdtdpafkgadsrellreawrriqakgytlgnvdvtiiaqapkmlphipqmrvfiaed
lgchmddvnvkattteklgftgrgegiaceavallikatk
Download sequence
Identical sequences 1gx1A 1gx1_A 1gx1_B 1gx1_C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]