SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1h4vB from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1h4vB
Domain Number 1 Region: 4-316
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 4.6e-93
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000000229
Further Details:      
 
Domain Number 2 Region: 328-420
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 7.09e-21
Family Anticodon-binding domain of Class II aaRS 0.00000435
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1h4vB   PDB: 1h4v
Sequence length 421
Comment (B:)
Sequence
mtaravrgtkdlfgkelrmhqrivatarkvleaagalelvtpifeetqvfekgvgaatdi
vrkemftfqdrggrsltlrpegtaamvraylehgmkvwpqpvrlwmagpmfraerpqkgr
yrqfhqvnyealgsenpildaeavvllyeclkelglrrlkvklssvgdpedrarynaylr
evlsphrealsedskerleenpmrildskserdqallkelgvrpmldflgeearahlkev
erhlerlsvpyelepalvrgldyyvrtafevhheeigaqsalggggrydglsellggprv
pgvgfafgvervalaleaegfglpeekgpdlyliplteeavaeafylaealrprlraeya
laprkpakgleealkrgaafagflgedelragevtlkrlatgeqvrlsreevpgyllqal
g
Download sequence
Identical sequences 1adj_A 1adj_B 1adj_C 1adj_D 1ady_A 1ady_B 1ady_C 1ady_D 1h4v_B 1h4vB

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]