SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1h8lA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1h8lA
Domain Number 1 Region: 9-299
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.75e-139
Family Pancreatic carboxypeptidases 0.000000000392
Further Details:      
 
Domain Number 2 Region: 302-378
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 6.54e-20
Family Carboxypeptidase regulatory domain 0.00000889
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1h8lA   PDB: 1h8l
Sequence length 380
Comment (A:)
Sequence
QAVQPVDFRHHHFSDMEIFLRRYANEYPSITRLYSVGKSVELRELYVMEISDNPGIHEAG
EPEFKYIGNMHGNEVVGRELLLNLIEYLCKNFGTDPEVTDLVQSTRIHIMPSMNPDGYEK
SQEGDRGGTVGRNNSNNYDLNRNFPDQFFQVTDPPQPETLAVMSWLKTYPFVLSANLHGG
SLVVNYPFDDDEQGIAIYSKSPDDAVFQQLALSYSKENKKMYQGSPCKDLYPTEYFPHGI
TNGAQWYNVPGGMQDWNYLNTNCFEVTIELGCVKYPKAEELPKYWEQNRRSLLQFIKQVH
RGIWGFVLDATDGRGILNATISVADINHPVTTYKDGDYWRLLVQGTYKVTASARGYDPVT
KTVEVDSKGGVQVNFTLSRT
Download sequence
Identical sequences P83852
1h8l_A 1qmu_A 1h8lA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]