SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1hc7A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1hc7A
Domain Number 1 Region: 13-276
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 9.91e-79
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000000181
Further Details:      
 
Domain Number 2 Region: 282-377
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 2.76e-38
Family Anticodon-binding domain of Class II aaRS 0.000000495
Further Details:      
 
Domain Number 3 Region: 405-477
Classification Level Classification E-value
Superfamily C-terminal domain of ProRS 5.16e-23
Family C-terminal domain of ProRS 0.00000736
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1hc7A   PDB: 1hc7
Sequence length 477
Comment (A:)
Sequence
MAKEKGLTPQSQDFSEWYLEVIQKAELADYGPVRGTIVVRPYGYAIWENIQQVLDRMFKE
TGHQNAYFPLFIPMSFLRKEAEHVEGFSPELAVVTHAGGEELEEPLAVRPTSETVIGYMW
SKWIRSWRDLPQLLNQWGNVVRWEMRTRPFLRTSEFLWQEGHTAHATREEAEEEVRRMLS
IYARLAREYAAIPVIEGLKTEKEKFAGAVYTTTIEALMKDGKALQAGTSHYLGENFARAF
DIKFQDRDLQVKYVHTTSWGLSWRFIGAIIMTHGDDRGLVLPPRLAPIQVVIVPIYKDES
RERVLEAAQGLRQALLAQGLRVHLDDRDQHTPGYKFHEWELKGVPFRVELGPKDLEGGQA
VLASRLGGKETLPLAALPEALPGKLDAFHEELYRRALAFREDHTRKVDTYEAFKEAVQEG
FALAFHCGDKACERLIQEETTATTRCVPFEAEPEEGFCVRCGRPSAYGKRVVFAKAY
Download sequence
Identical sequences Q5SM28
1h4q_A 1h4q_B 1h4s_A 1h4s_B 1h4t_A 1h4t_B 1h4t_C 1h4t_D 1hc7_A 1hc7_B 1hc7_C 1hc7_D gi|55980084|ref|YP_143381.1| YP_143381.1.19876 1hc7A 300852.TTHA0115

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]