SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1hdpA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1hdpA
Domain Number 1 Region: 1-60
Classification Level Classification E-value
Superfamily Homeodomain-like 6.42e-18
Family Homeodomain 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1hdpA   PDB: 1hdp   SUPERFAMILY: 1hdpA
Sequence length 63
Comment (A:)
Sequence
rrkkrtsietnvrfaleksflanqkptseeilliaeqlhmekevirvwfcnrrqkekrin
pcs
Download sequence
Identical sequences 1hdp_A cath|current|1hdpA00/1-63 d1hdpa_ 1hdpA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]