SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1hg8A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1hg8A
Domain Number 1 Region: 28-341
Classification Level Classification E-value
Superfamily Pectin lyase-like 2.81e-95
Family Galacturonase 0.000000000278
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1hg8A   PDB: 1hg8   SUPERFAMILY: 1hg8A
Sequence length 349
Comment (A:)
Sequence
dpcsvteysglatavsscknivlngfqvptgkqldlsslqndstvtfkgtttfattadnd
fnpivisgsnititgasghvidgngqaywdgkgsnsnsnqkpdhfivvqkttgnskitnl
niqnwpvhcfditgssqltisglildnragdkpnaksgslpaahntdgfdisssdhvtld
nnhvynqddcvavtsgtnivvsnmycsgghglsigsvggksdnvvdgvqflssqvvnsqn
gcriksnsgatgtinnvtyqnialtnistygvdvqqdylnggptgkptngvkisnikfik
vtgtvassaqdwfilcgdgscsgftfsgnaitgggktsscnyptntcps
Download sequence
Identical sequences 000007217|e1hg8A1|207.2.1.8|A:1-349 cath|current|1hg8A00/25-373 d1hg8a_ 1hg8A 1hg8_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]