SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1hi7A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1hi7A
Domain Number 1 Region: 4-60
Classification Level Classification E-value
Superfamily Trefoil 1.76e-18
Family Trefoil 0.0000164
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1hi7A   PDB: 1hi7   SUPERFAMILY: 1hi7A
Sequence length 60
Comment (A:)
Sequence
eaqtetctvaprerqncgfpgvtpsqcankgccfddtvrgvpwcfypntidvppeeecef
Download sequence
Identical sequences cath|current|1hi7A00/1-60 cath|current|1hi7B00/1-60 d1hi7a_ d1hi7b_ 1hi7A 1hi7_A 1hi7_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]