SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1hk5A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1hk5A
Domain Number 1 Region: 200-378
Classification Level Classification E-value
Superfamily Serum albumin-like 3.9e-76
Family Serum albumin-like 0.00066
Further Details:      
 
Domain Number 2 Region: 389-576
Classification Level Classification E-value
Superfamily Serum albumin-like 6.09e-74
Family Serum albumin-like 0.00067
Further Details:      
 
Domain Number 3 Region: 6-186
Classification Level Classification E-value
Superfamily Serum albumin-like 1.08e-69
Family Serum albumin-like 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1hk5A   PDB: 1hk5
Sequence length 585
Comment (A:)
Sequence
dahksevahrfkdlgeenfkalvliafaqylqqcpfedhvklvnevtefaktcvadesae
ncdkslhtlfgdklctvatlretygemadccakqepernecflqhkddnpnlprlvrpev
dvmctafhdneetflkkylyeiarrhpyfyapellffakrykaafteccqaadkaacllp
kldelrdegkassakqrlkcaslqkfgerafkawavahlsqrfpkaefaevsklvtdltk
vhtecchgdllecaddradlakyicenqdsissklkeccekpllekshciaevendempa
dlpslaadfveskdvcknyaeakdvflgmflyeyarrhpdysvvlllrlaktyettlekc
caaadphecyakvfdefkplveepqnlikqncelfeqlgeykfqnallvrytkkvpqvst
ptlvevsrnlgkvgskcckhpeakrmpcaedylsvvlnqlcvlhektpvsdrvtkcctes
lvnrrpcfsalevdetyvpkefnaetftfhadictlsekerqikkqtalvelvkhkpkat
keqlkavmddfaafvekcckaddketcfaeegkklvaasqaalgl
Download sequence
Identical sequences 1hk5A 1hk2_A 1hk5_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]