SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1hlvA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1hlvA
Domain Number 1 Region: 1-65
Classification Level Classification E-value
Superfamily Homeodomain-like 7.67e-18
Family Centromere-binding 0.000059
Further Details:      
 
Domain Number 2 Region: 72-130
Classification Level Classification E-value
Superfamily Homeodomain-like 1.57e-16
Family Centromere-binding 0.0000695
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1hlvA   PDB: 1hlv
Sequence length 131
Comment (A:)
Sequence
mgpkrrqltfreksriiqeveenpdlrkgeiarrfnippstlstilknkrailaserkyg
vastcrktnklspydkleglliawfqqiraaglpvkgiilkekalriaeelgmddftasn
gwldrfrrrrs
Download sequence
Identical sequences 1hlv_A trt001000209.1 1hlvA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]