SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1hm6A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1hm6A
Domain Number 1 Region: 36-346
Classification Level Classification E-value
Superfamily Annexin 4.61e-177
Family Annexin 0.000000014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1hm6A   PDB: 1hm6   SUPERFAMILY: 1hm6A
Sequence length 346
Comment (A:)
Sequence
mamvseflkqawfidneeqeyiktvkgskggpgsavspyptfnpssdvealhkaitvkgv
deatiieiltkrtnaqrqqikaaylqekgkpldealkkaltghleevalallktpaqfda
delraamkglgtdedtlneilasrtnreireinrvykeelkrdlakditsdtsgdyqkal
lslakgdrsedlainddladtdaralyeagerrkgtdlnvfitilttrsyphlrrvfqky
skyskhdmnkvldlelkgdiencltvvvkcatskpmffaeklhqamkgigtrhktlirim
vsrseidmndikacyqklygislcqaildetkgdyekilvalcggd
Download sequence
Identical sequences F1SJB5
1hm6A 1hm6_A 1hm6_B 1mcx_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]