SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1hqmA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1hqmA
Domain Number 1 Region: 50-171
Classification Level Classification E-value
Superfamily Insert subdomain of RNA polymerase alpha subunit 1.01e-38
Family Insert subdomain of RNA polymerase alpha subunit 0.000000481
Further Details:      
 
Domain Number 2 Region: 11-50,172-226
Classification Level Classification E-value
Superfamily RBP11-like subunits of RNA polymerase 5.64e-32
Family RNA polymerase alpha subunit dimerisation domain 0.0000179
Further Details:      
 
Domain Number 3 Region: 251-311
Classification Level Classification E-value
Superfamily C-terminal domain of RNA polymerase alpha subunit 5.86e-22
Family C-terminal domain of RNA polymerase alpha subunit 0.0000459
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1hqmA   PDB: 1hqm   SUPERFAMILY: 1hqmA
Sequence length 313
Comment (A:)
Sequence
mlesklkapvftattqgdhygefvleplergfgvtlgnplrrillssipgtavtsvyied
vlhefstipgvkedvveiilnlkelvvrfldprwrttlilraegpkevravdftpsadve
imnpdlhiatleeggklymevrvdrgvgyvpaerhgikdrinaipvdaifspvrrvafqv
edtrlgqrtdldkltlriwtdgsvtplealnqavailkehlnyfanpeasllptpevskg
ekresaeedldlpleelglstrvlhslkeegiesvrallalnlkdlrnipgigersleei
rqalakkgftlke
Download sequence
Identical sequences 1hqmA 1hqm_A 1hqm_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]