SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1httA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1httA
Domain Number 1 Region: 4-317
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 6.21e-106
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000000147
Further Details:      
 
Domain Number 2 Region: 328-422
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 3.02e-25
Family Anticodon-binding domain of Class II aaRS 0.0000043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1httA   PDB: 1htt
Sequence length 423
Comment (A:)
Sequence
akniqairgmndylpgetaiwqriegtlknvlgsygyseirlpiveqtplfkraigevtd
vvekemytfedrngdsltlrpegtagcvragiehgllynqeqrlwyigpmfrherpqkgr
yrqfhqlgcevfglqgpdidaelimltarwwralgisehvtlelnsigslearanyrdal
vafleqhkekldedckrrmytnplrvldsknpevqallndapalgdyldeesrehfaglc
kllesagiaytvnqrlvrgldyynrtvfewvtnslgsqgtvcaggrydglveqlggratp
avgfamglerlvllvqavnpefkadpvvdiylvasgadtqsaamalaerlrdelpgvklm
tnhgggnfkkqfaradkwgarvavvlgesevangtavvkdlrsgeqtavaqdsvaahlrt
llg
Download sequence
Identical sequences 1htt_A 1htt_B 1htt_C 1htt_D 1httA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]