SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1hv2A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1hv2A
Domain Number 1 Region: 2-99
Classification Level Classification E-value
Superfamily POZ domain 3.9e-36
Family BTB/POZ domain 0.00000607
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1hv2A   PDB: 1hv2   SUPERFAMILY: 1hv2A
Sequence length 99
Comment (A:)
Sequence
MSQDFVTLVSKDDKEYEISRSAAMISPTLKAMIEGPFRESKGRIELKQFDSHILEKAVEY
LNYNLKYSGVSEDDDEIPEFEIPTEMSLELLLAADYLSI
Download sequence
Identical sequences A0A250WDI1 A6ZWK2 C7GU08 G2WPD2 N1NVZ0 Q03071
YPL046C NP_015279.1.97178 1hv2A YPL046C tr|A6ZWK2|A6ZWK2_YEAS7 YPL046C YPL046C YPL046C 4932.YPL046C YPL046C YPL046C YPL046C 000006267|e1hv2A1|226.1.1.6|A:1-99 cath|current|1hv2A00/1-99 d1hv2a_ 1hv2_A YPL046C YPL046C YPL046C YPL046C YPL046C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]