SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1i4aA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1i4aA
Domain Number 1 Region: 7-318
Classification Level Classification E-value
Superfamily Annexin 8.06e-202
Family Annexin 0.000000175
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1i4aA   PDB: 1i4a   SUPERFAMILY: 1i4aA
Sequence length 318
Comment (A:)
Sequence
aakggdvkaasgfnaaedaqtlrkamkglgtdedaiinvlayrstaqrqeirtaykttig
rdlmddlkselsgnfeqvilgmmtptvlydvqelrkamkgagtdegclieilasrtpeei
rrinqtyqlqygrsleddirsdtsfmfqrvlvslsaggrdesnylddalmrqdaqdlyea
gekkwgtdevkfltvlcsrnrnhllhvfdeykriaqkdieqsiksetsgsfedallaivk
cmrnksayfaerlyksmkglgtdddtlirvmvsraeidmldiranfkrlygkslysfikg
dtsgdyrkvllilcggdd
Download sequence
Identical sequences 1i4a_A 1i4aA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]