SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1i60A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1i60A
Domain Number 1 Region: 9-275
Classification Level Classification E-value
Superfamily Xylose isomerase-like 5.57e-68
Family IolI-like 0.000000000251
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1i60A   PDB: 1i60   SUPERFAMILY: 1i60A
Sequence length 278
Comment (A:)
Sequence
MKLCFNEATTLENSNLKLDLELCEKHGYDYIEIRTMDKLPEYLKDHSLDDLAEYFQTHHI
KPLALNALVFFNNRDEKGHNEIITEFKGMMETCKTLGVKYVVAVPLVTEQKIVKEEIKKS
SVDVLTELSDIAEPYGVKIALEFVGHPQCTVNTFEQAYEIVNTVNRDNVGLVLDSFHFHA
MGSNIESLKQADGKKIFIYHIDDTEDFPIGFLTDEDRVWPGQGAIDLDAHLSALKEIGFS
DVVSVELFRPEYYKLTAEEAIQTAKKTTVDVVSKYFSM
Download sequence
Identical sequences A0A164USP3 A0A1D8FNS6 L8AVP7 P42419
NP_391847.1.22788 WP_003244546.1.11257 WP_003244546.1.1140 WP_003244546.1.12759 WP_003244546.1.15902 WP_003244546.1.16291 WP_003244546.1.2914 WP_003244546.1.32219 WP_003244546.1.33846 WP_003244546.1.36189 WP_003244546.1.39605 WP_003244546.1.40859 WP_003244546.1.44184 WP_003244546.1.45019 WP_003244546.1.47157 WP_003244546.1.56274 WP_003244546.1.56411 WP_003244546.1.57201 WP_003244546.1.5726 WP_003244546.1.57513 WP_003244546.1.6139 WP_003244546.1.6517 WP_003244546.1.65223 WP_003244546.1.72999 WP_003244546.1.76977 WP_003244546.1.78686 WP_003244546.1.81116 WP_003244546.1.81747 WP_003244546.1.82722 WP_003244546.1.88042 WP_003244546.1.91723 WP_003244546.1.93420 WP_003244546.1.94199 WP_003244546.1.96043 WP_003244546.1.979 000008794|e1i60A1|2002.1.1.18|A:1-278 000094007|e1i6nA1|2002.1.1.18|A:1-278 d1i60a_ d1i6na_ gi|16081019|ref|NP_391847.1| 224308.BSU39680 APC236 SR31 1i60_A 1i6n_A gi|402778133|ref|YP_006632077.1| gi|470164190|ref|YP_007535965.1| 1i60A gi|560131009|ref|YP_008832150.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]