SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1i6vA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1i6vA
Domain Number 1 Region: 50-172
Classification Level Classification E-value
Superfamily Insert subdomain of RNA polymerase alpha subunit 1.01e-39
Family Insert subdomain of RNA polymerase alpha subunit 0.000000343
Further Details:      
 
Domain Number 2 Region: 11-50,173-227
Classification Level Classification E-value
Superfamily RBP11-like subunits of RNA polymerase 5.64e-32
Family RNA polymerase alpha subunit dimerisation domain 0.0000181
Further Details:      
 
Domain Number 3 Region: 252-312
Classification Level Classification E-value
Superfamily C-terminal domain of RNA polymerase alpha subunit 5.86e-22
Family C-terminal domain of RNA polymerase alpha subunit 0.0000459
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1i6vA   PDB: 1i6v
Sequence length 314
Comment (A:)
Sequence
mlesklkapvftattqgdhygefvleplergfgvtlgnplrrillssipgtavtsvyied
vlhefstipgvkedvveiilnlkelvvrfldpkmasttlilraegpkevravdftpsadv
eimnpdlhiatleeggklymevrvdrgvgyvpaerhgikdrinaipvdaifspvrrvafq
vedtrlgqrtdldkltlriwtdgsvtplealnqavailkehlnyfanpeasslptpevsk
gekresaeedldlpleelglstrvlhslkeegiesvrallalnlkdlrnipgigerslee
irqalakkgftlke
Download sequence
Identical sequences 1i6vA 1i6v_A 1i6v_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]