SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1ic8A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1ic8A
Domain Number 1 Region: 4-95
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 1.55e-30
Family POU-specific domain 0.00000497
Further Details:      
 
Domain Number 2 Region: 108-192
Classification Level Classification E-value
Superfamily Homeodomain-like 3.12e-25
Family Homeodomain 0.0000128
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1ic8A   PDB: 1ic8
Sequence length 194
Comment (A:)
Sequence
ilkelenlspeeaahqkavvetllqedpwrvakmvksylqqhnipqrevvdttglnqshl
sqhlnkgtpmktqkraalytwyvrkqrevaqqfthagqgglieeptgdelptkkgrrnrf
kwgpasqqilfqayerqknpskeeretlveecnraeciqrgvspsqaqglgsnlvtevrv
ynwfanrrkeeafr
Download sequence
Identical sequences 1ic8_A 1ic8_B 1ic8A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]