SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1iciA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1iciA
Domain Number 1 Region: 14-250
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 3.25e-131
Family Sir2 family of transcriptional regulators 0.00000000478
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1iciA   PDB: 1ici   SUPERFAMILY: 1iciA
Sequence length 256
Comment (A:)
Sequence
gshhhhhhgshmdekllktiaeskylvaltgagvsaesgiptfrgkdglwnryrpeelan
pqafakdpekvwkwyawrmekvfnaqpnkahqafaelerlgvlkclitqnvddlherags
rnvihlhgslrvvrctscnnsfevesapkipplpkcdkcgsllrpgvvwfgemlppdvld
ramreveradviivagtsavvqpaaslplivkqrggaiieinpdetpltpiadyslrgka
gevmdelvrhvrkals
Download sequence
Identical sequences 1ici_A 1ici_B 1iciA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]