SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1idzA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1idzA
Domain Number 1 Region: 3-50
Classification Level Classification E-value
Superfamily Homeodomain-like 1.75e-29
Family Myb/SANT domain 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1idzA   PDB: 1idz   SUPERFAMILY: 1idzA
Sequence length 54
Comment (A:)
Sequence
mevkktswteeedrilyqahkrlgnrwaeiakllpgrtdnaiknhwnstmrrkv
Download sequence
Identical sequences 1idzA cath|current|1idyA00/140-193 cath|current|1idzA00/140-193 d1idya_ d1idza_ 1idy_A 1idz_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]