SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1iexA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1iexA
Domain Number 1 Region: 15-37,83-361
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.15e-144
Family NagZ-like 0.0000000000695
Further Details:      
 
Domain Number 2 Region: 389-598
Classification Level Classification E-value
Superfamily Beta-D-glucan exohydrolase, C-terminal domain 1.02e-56
Family Beta-D-glucan exohydrolase, C-terminal domain 0.00000000142
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1iexA   PDB: 1iex
Sequence length 605
Comment (A:)
Sequence
dyvlykdatkpvedrvadllgrmtlaekigqmtqierlvatpdvlrdnfigsllsgggsv
prkgatakewqdmvdgfqkacmstrlgipmiygidavhgqnnvygatifphnvglgatrd
pylvkrigeatalevratgiqyafapciavcrdprwgrcyesysedrrivqsmtelipgl
qgdvpkdftsgmpfvagknkvaacakhfvgdggtvdginenntiinreglmnihmpaykn
amdkgvstvmisysswngvkmhanqdlvtgylkdtlkfkgfvisdwegidrittpagsdy
sysvkasilagldmimvpnkyqqfisiltghvnggvipmsriddavtrilrvkftmglfe
npyadpamaeqlgkqehrdlareaarkslvllkngktstdapllplpkkapkilvagsha
dnlgyqcggwtiewqgdtgrttvgttileavkaavdpstvvvfaenpdaefvksggfsya
ivavgehpytetkgdnlnltipepglstvqavcggvrcatvlisgrpvvvqpllaasdal
vaawlpgsegqgvtdalfgdfgftgrlprtwfksvdqlpmnvgdahydplfrlgyglttn
atkky
Download sequence
Identical sequences 1iexA 1ex1_A 1ieq_A 1iev_A 1iew_A 1iex_A 1j8v_A 3wlh_A 3wlj_A 3wlk_X 3wll_A 3wlm_A 3wln_A 3wlp_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]