SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1ihpA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1ihpA
Domain Number 1 Region: 1-437
Classification Level Classification E-value
Superfamily Phosphoglycerate mutase-like 6.44e-111
Family Histidine acid phosphatase 0.0000000000000686
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1ihpA   PDB: 1ihp   SUPERFAMILY: 1ihpA
Sequence length 438
Comment (A:)
Sequence
scdtvdqgyqcfsetshlwgqyapffslanesvispevpagcrvtfaqvlsrhgaryptd
skgkkysalieeiqqnattfdgkyaflktynyslgaddltpfgeqelvnsgikfyqryes
ltrnivpfirssgssrviasgkkfiegfqstklkdpraqpgqsspkidvviseasssnnt
ldpgtctvfedseladtveanftatfvpsirqrlendlsgvtltdtevtylmdmcsfdti
ststvdtklspfcdlfthdewinydylqslkkyyghgagnplgptqgvgyaneliarlth
spvhddtssnhtldsspatfplnstlyadfshdngiisilfalglyngtkplstttveni
tqtdgfssawtvpfasrlyvemmqcqaeqeplvrvlvndrvvplhgcpvdalgrctrdsf
vrglsfarsggdwaecfa
Download sequence
Identical sequences 1ihpA 000139695|e3k4pA1|2111.21.1.2|A:7-444 000394424|e3k4pB1|2111.21.1.2|B:7-444 000394425|e3k4qA1|2111.21.1.2|A:7-444 000394426|e3k4qB1|2111.21.1.2|B:7-444 d1ihpa_ d3k4pa_ d3k4pb_ d3k4qa_ d3k4qb_ 1ihp_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]