SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1ijwC from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1ijwC
Domain Number 1 Region: 1-51
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000000575
Family Recombinase DNA-binding domain 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1ijwC   PDB: 1ijw   SUPERFAMILY: 1ijwC
Sequence length 52
Comment (C:)
Sequence
grprainkheqeqisrllekghprqqlaiifgigvstlyryfpassikkrmn
Download sequence
Identical sequences 1ijwC cath|current|1hcrA00/139-190 cath|current|1ijwC00/139-185 cath|current|1jj6C00/139-185 cath|current|1jj8C00/139-187 cath|current|1jkoC00/139-184 cath|current|1jkpC00/139-185 cath|current|1jkqC00/140-185 cath|current|1jkrC00/139-184 d1hcra_ 1hcr_A 1ijw_C 1jj6_C 1jj8_C 1jko_C 1jkp_C 1jkq_C 1jkr_C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]