SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1ik6A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1ik6A
Domain Number 1 Region: 52-251
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4.59e-73
Family Branched-chain alpha-keto acid dehydrogenase Pyr module 0.0000000145
Further Details:      
 
Domain Number 2 Region: 235-368
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 3.22e-39
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.000000406
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1ik6A   PDB: 1ik6
Sequence length 369
Comment (A:)
Sequence
hhhhhhssglvprgsgmketaaakfernhmdspdlgtddddkmvagvvmmanmakainma
lheemerdervvvlgedvgkkggvflvteglyerfgpervidtplneggilgfamgmama
glkpvaeiqfvdfiwlgadellnhiaklryrsggnykaplvvrtpvgsgtrgglyhsnsp
eaifvhtpglvvvmpstpynakgllkaairgddpvvflepkilyrapreevpegdyvvei
gkarvaregddvtlvtygavvhkaleaaervkasvevvdlqtlnpldfdtvlksvsktgr
liiahdspktgglgaevralvaekaldrltapvirlagpdvpqspiaadaayaptverii
kaieyvmry
Download sequence
Identical sequences 1ik6_A 1ik6A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]