SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1il2A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1il2A
Domain Number 1 Region: 121-305,397-556
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 3.93e-184
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000000642
Further Details:      
 
Domain Number 2 Region: 2-105
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.49e-59
Family Anticodon-binding domain 0.00000884
Further Details:      
 
Domain Number 3 Region: 288-419
Classification Level Classification E-value
Superfamily GAD domain-like 9.88e-47
Family GAD domain 0.000000198
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1il2A   PDB: 1il2
Sequence length 590
Comment (A:)
Sequence
MRTEYCGQLRLSHVGQQVTLCGWVNRRRDLGSLIFIDMRDREGIVQVFFDPDRADALKLA
SELRNEFCIQVTGTVRARDEKNINRDMATGEIEVLASSLTIINRADVLPLDSNHVNTEEA
RLKYRYLDLRRPEMAQRLKTRAKITSLVRRFMDDHGFLDIETPMLTKATPEGARDYLVPS
RVHKGKFYALPQSPQLFKQLLMMSGFDRYYQIVKCFRDEDLRADRQPEFTQIDVETSFMT
APQVREVMEALVRHLWLEVKGVDLGDFPVMTFAEAERRYGSDKPDLRNPMELTDVADLLK
SVEFAVFAGPANDPKGRVAALRVPGGASLTRKQIDEYGNFVKIYGAKGLAYIKVNERAKG
LEGINSPVAKFLNAEIIEDILDRTAAQDGDMIFFGADNKKIVADAMGALRLKVGKDLGLT
DESKWAPLWVIDFPMFEDDGEGGLTAMHHPFTSPKDMTAAELKAAPENAVANAYDMVING
YEVGGGSVRIHNGDMQQTVFGILGINEEEQREKFGFLLDALKYGTPPHAGLAFGLDRLTM
LLTGTDNIRDVIAFPKTTAAACLMTEAPSFANPTALAELSIQVVKKAENN
Download sequence
Identical sequences A0A0E0TZF9 A0A0E1LYG2 A0A0E1SVQ5 A0A140N996 A0A142H3W0 A0A1X3ING1 A0A1X3JGI4 A0A235JXL5 A0A238BAK2 A8A166 B1XHD4 C4ZQF0 D8EC05 P21889 S1F747 S1I746 T9E1J8 U9ZWH7 W1BGH6 W8SY33
gi|16129819|ref|NP_416380.1| gi|471333707|ref|YP_007557184.1| 316385.ECDH10B_2007 316407.aspS 331112.EcHS_A1959 413997.ECB_01837 469008.ECBD_1772 511145.b1866 595496.BWG_1680 gi|386614423|ref|YP_006134089.1| 1eqr_A 1eqr_B 1eqr_C 1il2_A 1il2_B gi|388477940|ref|YP_490128.1| gi|251785314|ref|YP_002999618.1| gi|157161335|ref|YP_001458653.1| gi|251785314|ref|YP_002999618.1| gi|254161926|ref|YP_003045034.1| gi|387621586|ref|YP_006129213.1| 1il2A NP_416380.1.90541 WP_001258678.1.100085 WP_001258678.1.100111 WP_001258678.1.100159 WP_001258678.1.100251 WP_001258678.1.10034 WP_001258678.1.100441 WP_001258678.1.100444 WP_001258678.1.100487 WP_001258678.1.100496 WP_001258678.1.10051 WP_001258678.1.100614 WP_001258678.1.100753 WP_001258678.1.100824 WP_001258678.1.10086 WP_001258678.1.100868 WP_001258678.1.100966 WP_001258678.1.101033 WP_001258678.1.101158 WP_001258678.1.101186 WP_001258678.1.101423 WP_001258678.1.101654 WP_001258678.1.101747 WP_001258678.1.10187 WP_001258678.1.10188 WP_001258678.1.10233 WP_001258678.1.10235 WP_001258678.1.10252 WP_001258678.1.10304 WP_001258678.1.10417 WP_001258678.1.10491 WP_001258678.1.1058 WP_001258678.1.10833 WP_001258678.1.11047 WP_001258678.1.11118 WP_001258678.1.1113 WP_001258678.1.11241 WP_001258678.1.11408 WP_001258678.1.11436 WP_001258678.1.1168 WP_001258678.1.11844 WP_001258678.1.11955 WP_001258678.1.11982 WP_001258678.1.12060 WP_001258678.1.1212 WP_001258678.1.12319 WP_001258678.1.12415 WP_001258678.1.12458 WP_001258678.1.12468 WP_001258678.1.12542 WP_001258678.1.12566 WP_001258678.1.12582 WP_001258678.1.12594 WP_001258678.1.12680 WP_001258678.1.12756 WP_001258678.1.12775 WP_001258678.1.12914 WP_001258678.1.13002 WP_001258678.1.13031 WP_001258678.1.13136 WP_001258678.1.13176 WP_001258678.1.13239 WP_001258678.1.13258 WP_001258678.1.13281 WP_001258678.1.13333 WP_001258678.1.1345 WP_001258678.1.13585 WP_001258678.1.13608 WP_001258678.1.13618 WP_001258678.1.13949 WP_001258678.1.13974 WP_001258678.1.14030 WP_001258678.1.1419 WP_001258678.1.14277 WP_001258678.1.14346 WP_001258678.1.1438 WP_001258678.1.14468 WP_001258678.1.14529 WP_001258678.1.1461 WP_001258678.1.14661 WP_001258678.1.1470 WP_001258678.1.14811 WP_001258678.1.14833 WP_001258678.1.14992 WP_001258678.1.1512 WP_001258678.1.15121 WP_001258678.1.15177 WP_001258678.1.15496 WP_001258678.1.15538 WP_001258678.1.15576 WP_001258678.1.15645 WP_001258678.1.15740 WP_001258678.1.15747 WP_001258678.1.1588 WP_001258678.1.16086 WP_001258678.1.1609 WP_001258678.1.16111 WP_001258678.1.16179 WP_001258678.1.16294 WP_001258678.1.1634 WP_001258678.1.16500 WP_001258678.1.16532 WP_001258678.1.16539 WP_001258678.1.16541 WP_001258678.1.1655 WP_001258678.1.16577 WP_001258678.1.16612 WP_001258678.1.16721 WP_001258678.1.16752 WP_001258678.1.17018 WP_001258678.1.17084 WP_001258678.1.17087 WP_001258678.1.17114 WP_001258678.1.17119 WP_001258678.1.17123 WP_001258678.1.17216 WP_001258678.1.17282 WP_001258678.1.17290 WP_001258678.1.17360 WP_001258678.1.17432 WP_001258678.1.17534 WP_001258678.1.1755 WP_001258678.1.17577 WP_001258678.1.1763 WP_001258678.1.17952 WP_001258678.1.17961 WP_001258678.1.18006 WP_001258678.1.18133 WP_001258678.1.18134 WP_001258678.1.18329 WP_001258678.1.18381 WP_001258678.1.18402 WP_001258678.1.18550 WP_001258678.1.18588 WP_001258678.1.18726 WP_001258678.1.18858 WP_001258678.1.18876 WP_001258678.1.19075 WP_001258678.1.19150 WP_001258678.1.19194 WP_001258678.1.19205 WP_001258678.1.19206 WP_001258678.1.193 WP_001258678.1.19313 WP_001258678.1.19361 WP_001258678.1.19441 WP_001258678.1.19644 WP_001258678.1.19655 WP_001258678.1.19684 WP_001258678.1.19691 WP_001258678.1.19795 WP_001258678.1.1982 WP_001258678.1.19878 WP_001258678.1.19889 WP_001258678.1.19940 WP_001258678.1.19957 WP_001258678.1.19994 WP_001258678.1.20151 WP_001258678.1.20164 WP_001258678.1.20170 WP_001258678.1.20308 WP_001258678.1.20318 WP_001258678.1.20331 WP_001258678.1.20445 WP_001258678.1.20506 WP_001258678.1.20515 WP_001258678.1.20596 WP_001258678.1.2063 WP_001258678.1.20638 WP_001258678.1.20724 WP_001258678.1.20737 WP_001258678.1.20982 WP_001258678.1.2100 WP_001258678.1.21017 WP_001258678.1.21020 WP_001258678.1.21033 WP_001258678.1.21057 WP_001258678.1.21122 WP_001258678.1.2142 WP_001258678.1.21470 WP_001258678.1.2156 WP_001258678.1.21573 WP_001258678.1.21661 WP_001258678.1.21733 WP_001258678.1.21758 WP_001258678.1.21771 WP_001258678.1.21823 WP_001258678.1.21915 WP_001258678.1.22060 WP_001258678.1.22113 WP_001258678.1.22195 WP_001258678.1.22359 WP_001258678.1.22363 WP_001258678.1.22450 WP_001258678.1.22574 WP_001258678.1.22579 WP_001258678.1.22632 WP_001258678.1.22649 WP_001258678.1.22669 WP_001258678.1.22690 WP_001258678.1.22783 WP_001258678.1.22830 WP_001258678.1.22885 WP_001258678.1.2300 WP_001258678.1.23044 WP_001258678.1.23090 WP_001258678.1.23383 WP_001258678.1.23511 WP_001258678.1.23549 WP_001258678.1.23676 WP_001258678.1.23898 WP_001258678.1.23945 WP_001258678.1.24045 WP_001258678.1.24089 WP_001258678.1.24124 WP_001258678.1.24136 WP_001258678.1.2418 WP_001258678.1.2428 WP_001258678.1.24316 WP_001258678.1.24362 WP_001258678.1.24499 WP_001258678.1.24583 WP_001258678.1.24616 WP_001258678.1.24693 WP_001258678.1.24876 WP_001258678.1.24899 WP_001258678.1.24960 WP_001258678.1.24984 WP_001258678.1.25042 WP_001258678.1.25085 WP_001258678.1.25141 WP_001258678.1.25183 WP_001258678.1.2531 WP_001258678.1.25312 WP_001258678.1.25324 WP_001258678.1.25643 WP_001258678.1.25713 WP_001258678.1.25843 WP_001258678.1.25996 WP_001258678.1.26379 WP_001258678.1.26480 WP_001258678.1.26517 WP_001258678.1.26588 WP_001258678.1.26609 WP_001258678.1.27057 WP_001258678.1.2712 WP_001258678.1.27134 WP_001258678.1.27292 WP_001258678.1.27451 WP_001258678.1.27560 WP_001258678.1.27611 WP_001258678.1.27742 WP_001258678.1.27774 WP_001258678.1.27879 WP_001258678.1.27923 WP_001258678.1.27971 WP_001258678.1.28268 WP_001258678.1.28271 WP_001258678.1.28509 WP_001258678.1.28662 WP_001258678.1.28697 WP_001258678.1.28711 WP_001258678.1.28760 WP_001258678.1.28809 WP_001258678.1.28863 WP_001258678.1.28982 WP_001258678.1.29016 WP_001258678.1.29061 WP_001258678.1.29128 WP_001258678.1.29221 WP_001258678.1.2926 WP_001258678.1.2942 WP_001258678.1.2945 WP_001258678.1.29746 WP_001258678.1.2995 WP_001258678.1.29967 WP_001258678.1.29992 WP_001258678.1.30231 WP_001258678.1.30247 WP_001258678.1.30253 WP_001258678.1.3045 WP_001258678.1.30472 WP_001258678.1.30479 WP_001258678.1.30546 WP_001258678.1.30554 WP_001258678.1.30630 WP_001258678.1.30639 WP_001258678.1.30749 WP_001258678.1.30783 WP_001258678.1.30843 WP_001258678.1.30866 WP_001258678.1.31000 WP_001258678.1.31142 WP_001258678.1.31211 WP_001258678.1.31379 WP_001258678.1.31407 WP_001258678.1.31421 WP_001258678.1.31506 WP_001258678.1.31614 WP_001258678.1.31681 WP_001258678.1.3169 WP_001258678.1.31833 WP_001258678.1.31839 WP_001258678.1.31898 WP_001258678.1.31928 WP_001258678.1.31978 WP_001258678.1.32093 WP_001258678.1.32121 WP_001258678.1.32127 WP_001258678.1.32143 WP_001258678.1.32394 WP_001258678.1.32479 WP_001258678.1.3248 WP_001258678.1.32509 WP_001258678.1.32591 WP_001258678.1.32601 WP_001258678.1.32722 WP_001258678.1.32815 WP_001258678.1.32903 WP_001258678.1.32984 WP_001258678.1.33004 WP_001258678.1.33244 WP_001258678.1.33325 WP_001258678.1.33385 WP_001258678.1.334 WP_001258678.1.33408 WP_001258678.1.33422 WP_001258678.1.33424 WP_001258678.1.33502 WP_001258678.1.33545 WP_001258678.1.33565 WP_001258678.1.33631 WP_001258678.1.33648 WP_001258678.1.33736 WP_001258678.1.33746 WP_001258678.1.33799 WP_001258678.1.33879 WP_001258678.1.33888 WP_001258678.1.33952 WP_001258678.1.33974 WP_001258678.1.3401 WP_001258678.1.34124 WP_001258678.1.342 WP_001258678.1.34270 WP_001258678.1.34277 WP_001258678.1.34341 WP_001258678.1.34363 WP_001258678.1.34444 WP_001258678.1.34525 WP_001258678.1.34532 WP_001258678.1.34538 WP_001258678.1.347 WP_001258678.1.34727 WP_001258678.1.34982 WP_001258678.1.34990 WP_001258678.1.34993 WP_001258678.1.35195 WP_001258678.1.35211 WP_001258678.1.35360 WP_001258678.1.35466 WP_001258678.1.35651 WP_001258678.1.35704 WP_001258678.1.35724 WP_001258678.1.35740 WP_001258678.1.35904 WP_001258678.1.3620 WP_001258678.1.36386 WP_001258678.1.36453 WP_001258678.1.36496 WP_001258678.1.36523 WP_001258678.1.36627 WP_001258678.1.3671 WP_001258678.1.36739 WP_001258678.1.36746 WP_001258678.1.36747 WP_001258678.1.36833 WP_001258678.1.37057 WP_001258678.1.37122 WP_001258678.1.3723 WP_001258678.1.37233 WP_001258678.1.37261 WP_001258678.1.37433 WP_001258678.1.37445 WP_001258678.1.37485 WP_001258678.1.37576 WP_001258678.1.37588 WP_001258678.1.3788 WP_001258678.1.37897 WP_001258678.1.37964 WP_001258678.1.38080 WP_001258678.1.38085 WP_001258678.1.38105 WP_001258678.1.3811 WP_001258678.1.38120 WP_001258678.1.38155 WP_001258678.1.38182 WP_001258678.1.38211 WP_001258678.1.38323 WP_001258678.1.38363 WP_001258678.1.38485 WP_001258678.1.38533 WP_001258678.1.38544 WP_001258678.1.38636 WP_001258678.1.38843 WP_001258678.1.38920 WP_001258678.1.38950 WP_001258678.1.38956 WP_001258678.1.39164 WP_001258678.1.39167 WP_001258678.1.39356 WP_001258678.1.39365 WP_001258678.1.39367 WP_001258678.1.39430 WP_001258678.1.39541 WP_001258678.1.39594 WP_001258678.1.39606 WP_001258678.1.3980 WP_001258678.1.39829 WP_001258678.1.39870 WP_001258678.1.39938 WP_001258678.1.39961 WP_001258678.1.39966 WP_001258678.1.40013 WP_001258678.1.40016 WP_001258678.1.40212 WP_001258678.1.40317 WP_001258678.1.40389 WP_001258678.1.40445 WP_001258678.1.40499 WP_001258678.1.40524 WP_001258678.1.40548 WP_001258678.1.40666 WP_001258678.1.40712 WP_001258678.1.40815 WP_001258678.1.40833 WP_001258678.1.40937 WP_001258678.1.40965 WP_001258678.1.41206 WP_001258678.1.4126 WP_001258678.1.41363 WP_001258678.1.41436 WP_001258678.1.41484 WP_001258678.1.41530 WP_001258678.1.41556 WP_001258678.1.41621 WP_001258678.1.41782 WP_001258678.1.41813 WP_001258678.1.41826 WP_001258678.1.41900 WP_001258678.1.41960 WP_001258678.1.42022 WP_001258678.1.42033 WP_001258678.1.42073 WP_001258678.1.42113 WP_001258678.1.4214 WP_001258678.1.42159 WP_001258678.1.42209 WP_001258678.1.42214 WP_001258678.1.42318 WP_001258678.1.42376 WP_001258678.1.4242 WP_001258678.1.42432 WP_001258678.1.42547 WP_001258678.1.42632 WP_001258678.1.42770 WP_001258678.1.4282 WP_001258678.1.4290 WP_001258678.1.42936 WP_001258678.1.42989 WP_001258678.1.4306 WP_001258678.1.43216 WP_001258678.1.43444 WP_001258678.1.43473 WP_001258678.1.43474 WP_001258678.1.43598 WP_001258678.1.43622 WP_001258678.1.43720 WP_001258678.1.43804 WP_001258678.1.44088 WP_001258678.1.44096 WP_001258678.1.44100 WP_001258678.1.44115 WP_001258678.1.44162 WP_001258678.1.44166 WP_001258678.1.44211 WP_001258678.1.44285 WP_001258678.1.44324 WP_001258678.1.44365 WP_001258678.1.44458 WP_001258678.1.44558 WP_001258678.1.44610 WP_001258678.1.44724 WP_001258678.1.44821 WP_001258678.1.44849 WP_001258678.1.44854 WP_001258678.1.44960 WP_001258678.1.44970 WP_001258678.1.44980 WP_001258678.1.45025 WP_001258678.1.45028 WP_001258678.1.45043 WP_001258678.1.45116 WP_001258678.1.4516 WP_001258678.1.45208 WP_001258678.1.45246 WP_001258678.1.45440 WP_001258678.1.4549 WP_001258678.1.45752 WP_001258678.1.45933 WP_001258678.1.45945 WP_001258678.1.45968 WP_001258678.1.46026 WP_001258678.1.46115 WP_001258678.1.46186 WP_001258678.1.46213 WP_001258678.1.46325 WP_001258678.1.46329 WP_001258678.1.46433 WP_001258678.1.46441 WP_001258678.1.46573 WP_001258678.1.46582 WP_001258678.1.4670 WP_001258678.1.46802 WP_001258678.1.46909 WP_001258678.1.46932 WP_001258678.1.47038 WP_001258678.1.47048 WP_001258678.1.47063 WP_001258678.1.47156 WP_001258678.1.4722 WP_001258678.1.47224 WP_001258678.1.47322 WP_001258678.1.47386 WP_001258678.1.47401 WP_001258678.1.47496 WP_001258678.1.47634 WP_001258678.1.47646 WP_001258678.1.47734 WP_001258678.1.47740 WP_001258678.1.47764 WP_001258678.1.47765 WP_001258678.1.47791 WP_001258678.1.48040 WP_001258678.1.48048 WP_001258678.1.48080 WP_001258678.1.48111 WP_001258678.1.48194 WP_001258678.1.48203 WP_001258678.1.48290 WP_001258678.1.48353 WP_001258678.1.48371 WP_001258678.1.48477 WP_001258678.1.48483 WP_001258678.1.48522 WP_001258678.1.486 WP_001258678.1.48847 WP_001258678.1.48926 WP_001258678.1.48953 WP_001258678.1.48974 WP_001258678.1.49009 WP_001258678.1.49363 WP_001258678.1.49531 WP_001258678.1.49537 WP_001258678.1.49645 WP_001258678.1.497 WP_001258678.1.49733 WP_001258678.1.49740 WP_001258678.1.49768 WP_001258678.1.49883 WP_001258678.1.49900 WP_001258678.1.50008 WP_001258678.1.50078 WP_001258678.1.5017 WP_001258678.1.50262 WP_001258678.1.50266 WP_001258678.1.50452 WP_001258678.1.5056 WP_001258678.1.50579 WP_001258678.1.5067 WP_001258678.1.50717 WP_001258678.1.51042 WP_001258678.1.5106 WP_001258678.1.51172 WP_001258678.1.51255 WP_001258678.1.51300 WP_001258678.1.51325 WP_001258678.1.51380 WP_001258678.1.51425 WP_001258678.1.51441 WP_001258678.1.5146 WP_001258678.1.51495 WP_001258678.1.51539 WP_001258678.1.51548 WP_001258678.1.51552 WP_001258678.1.51587 WP_001258678.1.51607 WP_001258678.1.51873 WP_001258678.1.52020 WP_001258678.1.52062 WP_001258678.1.52076 WP_001258678.1.52127 WP_001258678.1.52135 WP_001258678.1.52186 WP_001258678.1.52200 WP_001258678.1.52211 WP_001258678.1.52243 WP_001258678.1.52421 WP_001258678.1.52492 WP_001258678.1.52544 WP_001258678.1.52558 WP_001258678.1.5265 WP_001258678.1.52774 WP_001258678.1.52780 WP_001258678.1.52844 WP_001258678.1.52852 WP_001258678.1.52895 WP_001258678.1.53012 WP_001258678.1.53020 WP_001258678.1.53244 WP_001258678.1.53327 WP_001258678.1.53377 WP_001258678.1.53428 WP_001258678.1.53482 WP_001258678.1.53545 WP_001258678.1.53645 WP_001258678.1.53769 WP_001258678.1.53931 WP_001258678.1.53972 WP_001258678.1.53994 WP_001258678.1.54002 WP_001258678.1.54028 WP_001258678.1.54263 WP_001258678.1.54329 WP_001258678.1.54344 WP_001258678.1.54463 WP_001258678.1.54476 WP_001258678.1.54507 WP_001258678.1.54602 WP_001258678.1.54605 WP_001258678.1.5461 WP_001258678.1.54617 WP_001258678.1.5470 WP_001258678.1.54769 WP_001258678.1.55003 WP_001258678.1.55005 WP_001258678.1.55112 WP_001258678.1.55123 WP_001258678.1.55374 WP_001258678.1.55425 WP_001258678.1.55466 WP_001258678.1.55507 WP_001258678.1.55529 WP_001258678.1.55551 WP_001258678.1.55556 WP_001258678.1.55571 WP_001258678.1.55574 WP_001258678.1.55629 WP_001258678.1.55676 WP_001258678.1.55720 WP_001258678.1.55825 WP_001258678.1.55868 WP_001258678.1.5614 WP_001258678.1.56164 WP_001258678.1.56197 WP_001258678.1.56285 WP_001258678.1.56786 WP_001258678.1.56789 WP_001258678.1.56846 WP_001258678.1.56934 WP_001258678.1.56980 WP_001258678.1.57181 WP_001258678.1.57386 WP_001258678.1.57401 WP_001258678.1.57403 WP_001258678.1.57410 WP_001258678.1.57432 WP_001258678.1.57558 WP_001258678.1.57719 WP_001258678.1.5786 WP_001258678.1.57904 WP_001258678.1.58060 WP_001258678.1.58080 WP_001258678.1.58232 WP_001258678.1.58384 WP_001258678.1.58401 WP_001258678.1.5842 WP_001258678.1.58429 WP_001258678.1.58440 WP_001258678.1.58475 WP_001258678.1.58837 WP_001258678.1.58867 WP_001258678.1.58940 WP_001258678.1.58958 WP_001258678.1.58976 WP_001258678.1.59024 WP_001258678.1.59026 WP_001258678.1.59035 WP_001258678.1.59306 WP_001258678.1.59407 WP_001258678.1.59513 WP_001258678.1.59533 WP_001258678.1.59553 WP_001258678.1.59615 WP_001258678.1.5965 WP_001258678.1.59998 WP_001258678.1.60031 WP_001258678.1.60151 WP_001258678.1.60343 WP_001258678.1.60505 WP_001258678.1.60550 WP_001258678.1.60576 WP_001258678.1.6061 WP_001258678.1.6066 WP_001258678.1.60717 WP_001258678.1.60764 WP_001258678.1.60895 WP_001258678.1.60901 WP_001258678.1.61096 WP_001258678.1.61170 WP_001258678.1.61181 WP_001258678.1.61241 WP_001258678.1.61505 WP_001258678.1.61551 WP_001258678.1.61779 WP_001258678.1.61822 WP_001258678.1.61858 WP_001258678.1.61949 WP_001258678.1.62099 WP_001258678.1.62612 WP_001258678.1.62642 WP_001258678.1.62668 WP_001258678.1.62735 WP_001258678.1.62750 WP_001258678.1.62787 WP_001258678.1.62812 WP_001258678.1.62840 WP_001258678.1.62919 WP_001258678.1.62989 WP_001258678.1.63167 WP_001258678.1.6323 WP_001258678.1.63246 WP_001258678.1.6337 WP_001258678.1.63721 WP_001258678.1.64040 WP_001258678.1.64110 WP_001258678.1.6416 WP_001258678.1.64285 WP_001258678.1.6431 WP_001258678.1.64353 WP_001258678.1.64448 WP_001258678.1.647 WP_001258678.1.64749 WP_001258678.1.64784 WP_001258678.1.64912 WP_001258678.1.64926 WP_001258678.1.6499 WP_001258678.1.65040 WP_001258678.1.65151 WP_001258678.1.65256 WP_001258678.1.65271 WP_001258678.1.65353 WP_001258678.1.65364 WP_001258678.1.65415 WP_001258678.1.65596 WP_001258678.1.65912 WP_001258678.1.65961 WP_001258678.1.66050 WP_001258678.1.66127 WP_001258678.1.66197 WP_001258678.1.66251 WP_001258678.1.66280 WP_001258678.1.66327 WP_001258678.1.6635 WP_001258678.1.66387 WP_001258678.1.66389 WP_001258678.1.66501 WP_001258678.1.6654 WP_001258678.1.66550 WP_001258678.1.66559 WP_001258678.1.66624 WP_001258678.1.6665 WP_001258678.1.66700 WP_001258678.1.66719 WP_001258678.1.66933 WP_001258678.1.67021 WP_001258678.1.67137 WP_001258678.1.67200 WP_001258678.1.67293 WP_001258678.1.67415 WP_001258678.1.67454 WP_001258678.1.67468 WP_001258678.1.67538 WP_001258678.1.67553 WP_001258678.1.67732 WP_001258678.1.67786 WP_001258678.1.67787 WP_001258678.1.67861 WP_001258678.1.67975 WP_001258678.1.67990 WP_001258678.1.68008 WP_001258678.1.68025 WP_001258678.1.6803 WP_001258678.1.68079 WP_001258678.1.6814 WP_001258678.1.68283 WP_001258678.1.68341 WP_001258678.1.68396 WP_001258678.1.68534 WP_001258678.1.68697 WP_001258678.1.68711 WP_001258678.1.6877 WP_001258678.1.68797 WP_001258678.1.68801 WP_001258678.1.68915 WP_001258678.1.68989 WP_001258678.1.69127 WP_001258678.1.6916 WP_001258678.1.6923 WP_001258678.1.69247 WP_001258678.1.69258 WP_001258678.1.69261 WP_001258678.1.69303 WP_001258678.1.69305 WP_001258678.1.6945 WP_001258678.1.69473 WP_001258678.1.69583 WP_001258678.1.69593 WP_001258678.1.69646 WP_001258678.1.69803 WP_001258678.1.70213 WP_001258678.1.70407 WP_001258678.1.70619 WP_001258678.1.70767 WP_001258678.1.70794 WP_001258678.1.7090 WP_001258678.1.71024 WP_001258678.1.71159 WP_001258678.1.71229 WP_001258678.1.71272 WP_001258678.1.71285 WP_001258678.1.71312 WP_001258678.1.71315 WP_001258678.1.71323 WP_001258678.1.71397 WP_001258678.1.71403 WP_001258678.1.71409 WP_001258678.1.71480 WP_001258678.1.71522 WP_001258678.1.71632 WP_001258678.1.71690 WP_001258678.1.71783 WP_001258678.1.71837 WP_001258678.1.71938 WP_001258678.1.71944 WP_001258678.1.71975 WP_001258678.1.71993 WP_001258678.1.72033 WP_001258678.1.72053 WP_001258678.1.7210 WP_001258678.1.72157 WP_001258678.1.72184 WP_001258678.1.7225 WP_001258678.1.72279 WP_001258678.1.72337 WP_001258678.1.72397 WP_001258678.1.72431 WP_001258678.1.72485 WP_001258678.1.72511 WP_001258678.1.72537 WP_001258678.1.72544 WP_001258678.1.72606 WP_001258678.1.72616 WP_001258678.1.72745 WP_001258678.1.72747 WP_001258678.1.72860 WP_001258678.1.72910 WP_001258678.1.72947 WP_001258678.1.73085 WP_001258678.1.73129 WP_001258678.1.73217 WP_001258678.1.73385 WP_001258678.1.73524 WP_001258678.1.73565 WP_001258678.1.7376 WP_001258678.1.73843 WP_001258678.1.73844 WP_001258678.1.73859 WP_001258678.1.73942 WP_001258678.1.7411 WP_001258678.1.74123 WP_001258678.1.74184 WP_001258678.1.74309 WP_001258678.1.74365 WP_001258678.1.74445 WP_001258678.1.74520 WP_001258678.1.7461 WP_001258678.1.74625 WP_001258678.1.74688 WP_001258678.1.74691 WP_001258678.1.74713 WP_001258678.1.7475 WP_001258678.1.74962 WP_001258678.1.74998 WP_001258678.1.75139 WP_001258678.1.75145 WP_001258678.1.75149 WP_001258678.1.75367 WP_001258678.1.75428 WP_001258678.1.75435 WP_001258678.1.75515 WP_001258678.1.75537 WP_001258678.1.75612 WP_001258678.1.75653 WP_001258678.1.75672 WP_001258678.1.75679 WP_001258678.1.75687 WP_001258678.1.75699 WP_001258678.1.75735 WP_001258678.1.75758 WP_001258678.1.75995 WP_001258678.1.76039 WP_001258678.1.76184 WP_001258678.1.76196 WP_001258678.1.76211 WP_001258678.1.76312 WP_001258678.1.76361 WP_001258678.1.76446 WP_001258678.1.76462 WP_001258678.1.76547 WP_001258678.1.76562 WP_001258678.1.76701 WP_001258678.1.76815 WP_001258678.1.76909 WP_001258678.1.77175 WP_001258678.1.77214 WP_001258678.1.7728 WP_001258678.1.77291 WP_001258678.1.77358 WP_001258678.1.77470 WP_001258678.1.77503 WP_001258678.1.77595 WP_001258678.1.77636 WP_001258678.1.77648 WP_001258678.1.77768 WP_001258678.1.77876 WP_001258678.1.7808 WP_001258678.1.78089 WP_001258678.1.78196 WP_001258678.1.78321 WP_001258678.1.78462 WP_001258678.1.7847 WP_001258678.1.78481 WP_001258678.1.78583 WP_001258678.1.78615 WP_001258678.1.78718 WP_001258678.1.78750 WP_001258678.1.78791 WP_001258678.1.78953 WP_001258678.1.79004 WP_001258678.1.79086 WP_001258678.1.79246 WP_001258678.1.79306 WP_001258678.1.79478 WP_001258678.1.79558 WP_001258678.1.79685 WP_001258678.1.79764 WP_001258678.1.79816 WP_001258678.1.79840 WP_001258678.1.7985 WP_001258678.1.7987 WP_001258678.1.79871 WP_001258678.1.79984 WP_001258678.1.80060 WP_001258678.1.80136 WP_001258678.1.80183 WP_001258678.1.80255 WP_001258678.1.80320 WP_001258678.1.80428 WP_001258678.1.80517 WP_001258678.1.80524 WP_001258678.1.8057 WP_001258678.1.80612 WP_001258678.1.80626 WP_001258678.1.80662 WP_001258678.1.80804 WP_001258678.1.8090 WP_001258678.1.81054 WP_001258678.1.81286 WP_001258678.1.81313 WP_001258678.1.81576 WP_001258678.1.81589 WP_001258678.1.81618 WP_001258678.1.81715 WP_001258678.1.81723 WP_001258678.1.81806 WP_001258678.1.81832 WP_001258678.1.81935 WP_001258678.1.81939 WP_001258678.1.82316 WP_001258678.1.82439 WP_001258678.1.82536 WP_001258678.1.82700 WP_001258678.1.82715 WP_001258678.1.82754 WP_001258678.1.82853 WP_001258678.1.83020 WP_001258678.1.83093 WP_001258678.1.83097 WP_001258678.1.831 WP_001258678.1.83140 WP_001258678.1.83144 WP_001258678.1.83205 WP_001258678.1.83224 WP_001258678.1.83415 WP_001258678.1.8345 WP_001258678.1.83544 WP_001258678.1.83735 WP_001258678.1.83781 WP_001258678.1.83820 WP_001258678.1.83941 WP_001258678.1.8411 WP_001258678.1.84210 WP_001258678.1.84298 WP_001258678.1.84331 WP_001258678.1.84405 WP_001258678.1.84410 WP_001258678.1.8444 WP_001258678.1.84467 WP_001258678.1.84534 WP_001258678.1.84584 WP_001258678.1.8470 WP_001258678.1.84875 WP_001258678.1.84877 WP_001258678.1.84977 WP_001258678.1.84989 WP_001258678.1.84994 WP_001258678.1.85002 WP_001258678.1.85052 WP_001258678.1.85216 WP_001258678.1.85247 WP_001258678.1.85260 WP_001258678.1.85310 WP_001258678.1.85323 WP_001258678.1.85500 WP_001258678.1.8560 WP_001258678.1.85621 WP_001258678.1.85752 WP_001258678.1.85773 WP_001258678.1.85857 WP_001258678.1.8592 WP_001258678.1.86001 WP_001258678.1.86016 WP_001258678.1.86161 WP_001258678.1.86189 WP_001258678.1.8621 WP_001258678.1.86228 WP_001258678.1.86276 WP_001258678.1.86412 WP_001258678.1.86452 WP_001258678.1.86461 WP_001258678.1.86475 WP_001258678.1.86609 WP_001258678.1.86691 WP_001258678.1.86787 WP_001258678.1.86848 WP_001258678.1.86959 WP_001258678.1.87199 WP_001258678.1.87389 WP_001258678.1.87563 WP_001258678.1.87610 WP_001258678.1.87721 WP_001258678.1.87857 WP_001258678.1.87919 WP_001258678.1.88017 WP_001258678.1.88110 WP_001258678.1.88301 WP_001258678.1.88304 WP_001258678.1.88434 WP_001258678.1.88598 WP_001258678.1.88710 WP_001258678.1.88711 WP_001258678.1.88757 WP_001258678.1.8879 WP_001258678.1.88834 WP_001258678.1.89090 WP_001258678.1.89099 WP_001258678.1.89416 WP_001258678.1.89458 WP_001258678.1.89468 WP_001258678.1.89674 WP_001258678.1.89679 WP_001258678.1.89899 WP_001258678.1.89923 WP_001258678.1.89927 WP_001258678.1.89977 WP_001258678.1.90017 WP_001258678.1.90078 WP_001258678.1.90168 WP_001258678.1.90256 WP_001258678.1.90358 WP_001258678.1.9036 WP_001258678.1.90389 WP_001258678.1.90511 WP_001258678.1.90520 WP_001258678.1.90536 WP_001258678.1.90703 WP_001258678.1.90799 WP_001258678.1.90828 WP_001258678.1.91018 WP_001258678.1.91121 WP_001258678.1.91170 WP_001258678.1.91277 WP_001258678.1.91340 WP_001258678.1.91341 WP_001258678.1.91445 WP_001258678.1.91640 WP_001258678.1.9169 WP_001258678.1.91850 WP_001258678.1.91994 WP_001258678.1.92161 WP_001258678.1.92180 WP_001258678.1.92323 WP_001258678.1.92496 WP_001258678.1.92568 WP_001258678.1.92614 WP_001258678.1.9264 WP_001258678.1.92668 WP_001258678.1.92742 WP_001258678.1.92792 WP_001258678.1.92845 WP_001258678.1.92865 WP_001258678.1.92943 WP_001258678.1.93019 WP_001258678.1.93033 WP_001258678.1.93048 WP_001258678.1.93054 WP_001258678.1.93175 WP_001258678.1.93276 WP_001258678.1.93309 WP_001258678.1.93312 WP_001258678.1.93629 WP_001258678.1.93634 WP_001258678.1.93673 WP_001258678.1.93755 WP_001258678.1.93911 WP_001258678.1.93971 WP_001258678.1.94025 WP_001258678.1.94057 WP_001258678.1.94176 WP_001258678.1.94271 WP_001258678.1.94388 WP_001258678.1.94445 WP_001258678.1.94542 WP_001258678.1.9457 WP_001258678.1.94626 WP_001258678.1.94695 WP_001258678.1.94764 WP_001258678.1.948 WP_001258678.1.9489 WP_001258678.1.94898 WP_001258678.1.94938 WP_001258678.1.94949 WP_001258678.1.94993 WP_001258678.1.95037 WP_001258678.1.95332 WP_001258678.1.95395 WP_001258678.1.95438 WP_001258678.1.95595 WP_001258678.1.95827 WP_001258678.1.95849 WP_001258678.1.95919 WP_001258678.1.95931 WP_001258678.1.95932 WP_001258678.1.96215 WP_001258678.1.96279 WP_001258678.1.96281 WP_001258678.1.96290 WP_001258678.1.96299 WP_001258678.1.96303 WP_001258678.1.96339 WP_001258678.1.96394 WP_001258678.1.9657 WP_001258678.1.97011 WP_001258678.1.97119 WP_001258678.1.9723 WP_001258678.1.97231 WP_001258678.1.97439 WP_001258678.1.9747 WP_001258678.1.97560 WP_001258678.1.97825 WP_001258678.1.97930 WP_001258678.1.98220 WP_001258678.1.98235 WP_001258678.1.98244 WP_001258678.1.98424 WP_001258678.1.98442 WP_001258678.1.98477 WP_001258678.1.98578 WP_001258678.1.9858 WP_001258678.1.98614 WP_001258678.1.98628 WP_001258678.1.9864 WP_001258678.1.98776 WP_001258678.1.99265 WP_001258678.1.99310 WP_001258678.1.99319 WP_001258678.1.99392 WP_001258678.1.99400 WP_001258678.1.99453 WP_001258678.1.99562 WP_001258678.1.99602 gi|238901081|ref|YP_002926877.1| gi|253773177|ref|YP_003036008.1| gi|170081522|ref|YP_001730842.1| gi|387621586|ref|YP_006129213.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]