SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1ilyA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1ilyA
Domain Number 1 Region: 1-88
Classification Level Classification E-value
Superfamily Translational machinery components 4.25e-43
Family Ribosomal protein L18 and S11 0.00000438
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1ilyA   PDB: 1ily   SUPERFAMILY: 1ilyA
Sequence length 90
Comment (A:)
Sequence
rlrlsvfrslkhiyaqiiddekgvtlvsasslalklkgnktevarqvgralaekalalgi
kqvafdrgpykyhgrvkalaegaregglef
Download sequence
Identical sequences 001949951|e1ilyA1|2484.1.1.405|A:1-90 cath|current|1ilyA00/22-111 d1ilya_ 1ilyA 1ily_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]