SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1ilzA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1ilzA
Domain Number 1 Region: 25-274
Classification Level Classification E-value
Superfamily Outer membrane phospholipase A (OMPLA) 6.95e-91
Family Outer membrane phospholipase A (OMPLA) 0.000000000213
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1ilzA   PDB: 1ilz   SUPERFAMILY: 1ilzA
Sequence length 275
Comment (A:)
Sequence
arirapqeatvkevhdapavrgsiianmlqehdnpftlypydtnyliytqtsdlnkeaia
sydwaenarkdevkfqlslafplwrgilgpnsvlgasytqkswwqlsnseesspfretny
epqlflgfatdyrfagwtlrdvemgynhdsngrsdptsrswarlytrlmaengnwlvevk
pwyvvgntddnpditkymgyyqlkigyhlgdavlsakgqynwntgyggaelglsypitkh
vrlytqvysgygeslidynfnqtrvgvgvmlndlf
Download sequence
Identical sequences 1ild_A 1ilz_A 1im0_A 1ilzA cath|current|1im0A00/8-269

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]