SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1iru2 from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1iru2
Domain Number 1 Region: 2-214
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 9.43e-60
Family Proteasome subunits 0.00000000411
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1iru2   PDB: 1iru   SUPERFAMILY: 1iru2
Sequence length 219
Comment (2:)
Sequence
tqnpmvtgtsvlgvkfeggvviaadmlgsygslarfrnisrimrvnnstmlgasgdyadf
qylkqvlgqmvideellgdghsyspraihswltramysrrskmnplwntmviggyadges
flgyvdmlgvayeapslatgygaylaqpllrevlekqpvlsqteardlvercmrvlyyrd
arsynrfqtatvtekgveiegplstetnwdiahmisgfe
Download sequence
Identical sequences 1iru_2 1iru_N 1iru2 cath|current|1iru200/1-217 cath|current|1iruN00/1-217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]