SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1iruF from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1iruF
Domain Number 1 Region: 20-229
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 9.77e-81
Family Proteasome subunits 0.0000000044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1iruF   PDB: 1iru   SUPERFAMILY: 1iruF
Sequence length 263
Comment (F:)
Sequence
MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQ
KKILHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPT
QRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMSIGARSQSARTYLERHMSEFM
ECNLNELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDLEFTIYDDDDVSPFLEGLEERP
QRKAQPAQPADEPAEKADEPMEH
Download sequence
Identical sequences A0A096N1M9 A0A0P6JBN0 A0A1U7UJU2 A0A286Y2Q2 A0A287CTN6 A0A2I2YT52 A0A2K5I468 A0A2K5KTR2 A0A2K5W3E4 A0A2K5YBD2 A0A2K6APR2 A0A2K6LVB7 A0A2K6QGL0 F2Z5L7 F7GW13 H2NE16 H9ENP5 K7BLE3 P25786
ENSSSCP00000014233 9600.ENSPPYP00000003979 9823.ENSSSCP00000014233 9986.ENSOCUP00000000384 ENSPPYP00000003979 1iru_F 1iru_T 5a0q_F 5a0q_T 5gjq_G 5gjq_m 5gjr_G 5gjr_m 5l4g_F 5l4g_S 5le5_E 5le5_S 5lex_E 5lex_S 5ley_E 5ley_S 5lez_E 5lez_S 5lf0_E 5lf0_S 5lf1_E 5lf1_S 5lf3_E 5lf3_S 5lf4_E 5lf4_S 5lf6_E 5lf6_S 5lf7_E 5lf7_S 5ln3_F 6avo_G 6avo_L 1iruF ENSP00000379675 ENSP00000379676 ENSSSCP00000014233 ENSP00000379676 gi|4506179|ref|NP_002777.1| NP_001247950.1.72884 NP_002777.1.87134 NP_002777.1.92137 XP_002708872.1.1745 XP_002755033.1.60252 XP_003123013.1.46622 XP_003465807.2.53824 XP_003818239.1.60992 XP_004683082.1.23501 XP_004851526.1.39548 XP_005326833.1.77405 XP_005380389.1.28644 XP_006089640.1.53796 XP_006191887.1.101512 XP_006209401.1.17985 XP_006773255.1.95426 XP_006905725.1.64745 XP_008004277.1.81039 XP_008066126.1.4292 XP_010386680.1.97406 XP_010613521.1.5607 XP_010963136.1.22495 XP_010975547.1.51371 XP_011372477.1.92234 XP_011748373.1.29376 XP_011811645.1.43180 XP_011854959.1.47321 XP_011937287.1.92194 XP_015333144.1.40921 XP_017737035.1.44346 XP_508298.3.37143 ENSOCUP00000000384 ENSPPYP00000003979 ENSCJAP00000018435

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]