SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1itzA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1itzA
Domain Number 1 Region: 19-341
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.38e-227
Family TK-like PP module 0.000000989
Further Details:      
 
Domain Number 2 Region: 348-537
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.39e-115
Family TK-like Pyr module 0.00012
Further Details:      
 
Domain Number 3 Region: 547-674
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 9.52e-65
Family Transketolase C-terminal domain-like 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1itzA   PDB: 1itz
Sequence length 675
Comment (A:)
Sequence
GAVETLQGKAATGELLEKSVNTIRFLAIDAVEKANSGHPGLPMGCAPMGHVLYDEVMRYN
PKNPYWFNRDRFVLSAGHGCMLQYALLHLAGYDSVKEEDLKQFRQWGSRTPGHPENFETP
GVEVTTGPLGQGIANAVGLALAEKHLAARFNKPDSEIVDHYTYVILGDGCQMEGIANEAC
SLAGHWGLGKLIAFYDDNHISIDGDTEIAFTEDVSTRFEALGWHTIWVKNGNTGYDDIRA
AIKEAKAVTDKPTLIKVTTTIGFGSPNKANSYSVHGSALGAKEVEATRQNLGWPYDTFFV
PEDVKSHWSRHTPEGAALEADWNAKFAEYEKKYADDAATLKSIITGELPTGWVDALPKYT
PESPGDATRNLSQQCLNALANVVPGLIGGSADLASSNMTLLKMFGDFQKDTAEERNVRFG
VREHGMGAICNGIALHSPGFVPYCATFFVFTDYMRGAMRISALSEAGVIYVMTHDSIGLG
EDGPTHQPIEHLVSFRAMPNILMLRPADGNETAGAYKVAVLNRKRPSILALSRQKLPHLP
GTSIEGVEKGGYTISDNSTGNKPDLIVMGTGSELEIAAKAADELRKEGKTVRVVSFVSWE
LFDEQSDEYKESVLPAAVTARISIEAGSTLGWQKYVGAQGKAIGIDKFGASAPAGTIYKE
YGITVESIIAAAKSF
Download sequence
Identical sequences Q7SIC9
1itzA 1itz_A 1itz_B 1itz_C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]