SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1iufA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1iufA
Domain Number 1 Region: 2-78
Classification Level Classification E-value
Superfamily Homeodomain-like 2.19e-27
Family Centromere-binding 0.0000129
Further Details:      
 
Domain Number 2 Region: 80-143
Classification Level Classification E-value
Superfamily Homeodomain-like 7.3e-16
Family Centromere-binding 0.0000202
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1iufA   PDB: 1iuf
Sequence length 144
Comment (A:)
Sequence
gihmgkikrraitehekralrhyffqlqnrsgqqdliewfrekfgkdisqpsvsqilssk
ysyldntvekpwdvkrnrppkyplleaalfewqvqqgddatlsgetikraaailwhkipe
yqdqpvpnfsngwlegfrkrhilh
Download sequence
Identical sequences 1iufA my_001000008.1 1iuf_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]