SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1ixmA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1ixmA
Domain Number 1 Region: 15-190
Classification Level Classification E-value
Superfamily Sporulation response regulatory protein Spo0B 1.39e-67
Family Sporulation response regulatory protein Spo0B 0.00000000949
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1ixmA   PDB: 1ixm   SUPERFAMILY: 1ixmA
Sequence length 192
Comment (A:)
Sequence
MKDVSKNQEENISDTALTNELIHLLGHSRHDWMNKLQLIKGNLSLQKYDRVFEMIEEMVI
DAKHESKLSNLKTPHLAFDFLTFNWKTHYMTLEYEVLGEIKDLSAYDQKLAKLMRKLFHL
FDQAVSRESENHLTVSLQTDHPDRQLILYLDFHGAFADPSAFDDIRQNGYEDVDIMRFEI
TSHECLIEIGLD
Download sequence
Identical sequences A0A063XGM7 A0A0T8PK62 A0A125UKW8 A0A199WJA3 A0A1X7F8Q3 A0A285KRH5 L8AKR4 P06535 U1ZAN0
gi|402776949|ref|YP_006630893.1| 1ixmA 224308.BSU27930 gi|560129758|ref|YP_008830899.1| NP_390671.1.22788 WP_004399131.1.100042 WP_004399131.1.101301 WP_004399131.1.11231 WP_004399131.1.11257 WP_004399131.1.1140 WP_004399131.1.11581 WP_004399131.1.12644 WP_004399131.1.12759 WP_004399131.1.1358 WP_004399131.1.14761 WP_004399131.1.15902 WP_004399131.1.16291 WP_004399131.1.18944 WP_004399131.1.19261 WP_004399131.1.20099 WP_004399131.1.21045 WP_004399131.1.23108 WP_004399131.1.25531 WP_004399131.1.27372 WP_004399131.1.27660 WP_004399131.1.2914 WP_004399131.1.31028 WP_004399131.1.31100 WP_004399131.1.32025 WP_004399131.1.32219 WP_004399131.1.32420 WP_004399131.1.32693 WP_004399131.1.32861 WP_004399131.1.33846 WP_004399131.1.34621 WP_004399131.1.35833 WP_004399131.1.36189 WP_004399131.1.37074 WP_004399131.1.39562 WP_004399131.1.39605 WP_004399131.1.40859 WP_004399131.1.42762 WP_004399131.1.43852 WP_004399131.1.44140 WP_004399131.1.44184 WP_004399131.1.45019 WP_004399131.1.47157 WP_004399131.1.52860 WP_004399131.1.54596 WP_004399131.1.54948 WP_004399131.1.56274 WP_004399131.1.56411 WP_004399131.1.57184 WP_004399131.1.57201 WP_004399131.1.5726 WP_004399131.1.57513 WP_004399131.1.6139 WP_004399131.1.63795 WP_004399131.1.64889 WP_004399131.1.6517 WP_004399131.1.65188 WP_004399131.1.65223 WP_004399131.1.65841 WP_004399131.1.69439 WP_004399131.1.7159 WP_004399131.1.7186 WP_004399131.1.71916 WP_004399131.1.72152 WP_004399131.1.72516 WP_004399131.1.72999 WP_004399131.1.74782 WP_004399131.1.76814 WP_004399131.1.76977 WP_004399131.1.78686 WP_004399131.1.78811 WP_004399131.1.79712 WP_004399131.1.79987 WP_004399131.1.80832 WP_004399131.1.81116 WP_004399131.1.81747 WP_004399131.1.82722 WP_004399131.1.84556 WP_004399131.1.87300 WP_004399131.1.88042 WP_004399131.1.88382 WP_004399131.1.88591 WP_004399131.1.89000 WP_004399131.1.89821 WP_004399131.1.90830 WP_004399131.1.9164 WP_004399131.1.91723 WP_004399131.1.93073 WP_004399131.1.93420 WP_004399131.1.94199 WP_004399131.1.95009 WP_004399131.1.95211 WP_004399131.1.96043 WP_004399131.1.97264 WP_004399131.1.979 WP_004399131.1.99399 gi|384176375|ref|YP_005557760.1| gi|16079845|ref|NP_390671.1| gi|321312323|ref|YP_004204610.1| gi|430755926|ref|YP_007208703.1| gi|470163006|ref|YP_007534781.1| 1ixm_A 1ixm_B 2ftk_A 2ftk_B 2ftk_C 2ftk_D

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]