SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1iyeA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1iyeA
Domain Number 1 Region: 7-304
Classification Level Classification E-value
Superfamily D-aminoacid aminotransferase-like PLP-dependent enzymes 4.32e-158
Family D-aminoacid aminotransferase-like PLP-dependent enzymes 0.000000038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1iyeA   PDB: 1iye   SUPERFAMILY: 1iyeA
Sequence length 309
Comment (A:)
Sequence
MTTKKADYIWFNGEMVRWEDAKVHVMSHALHYGTSVFEGIRCYDSHKGPVVFRHREHMQR
LHDSAKIYRFPVSQSIDELMEACRDVIRKNNLTSAYIRPLIFVGDVGMGVNPPAGYSTDV
IIAAFPWGAYLGAEALEQGIDAMVSSWNRAAPNTIPTAAKAGGNYLSSLLVGSEARRHGY
QEGIALDVNGYISEGAGENLFEVKDGVLFTPPFTSSALPGITRDAIIKLAKELGIEVREQ
VLSRESLYLADEVFMSGTAAEITPVRSVDGIQVGEGRCGPVTKRIQQAFFGLFTGETEDK
WGWLDQVNQ
Download sequence
Identical sequences A0A023Z5F9 A0A024KKE3 A0A025C2I9 A0A026UYX5 A0A027TG46 A0A027ZKI1 A0A028E371 A0A062Y4F4 A0A064T5C9 A0A069XPK9 A0A070FBC7 A0A070SN65 A0A070ULP9 A0A073FML9 A0A073H395 A0A073UJN2 A0A074HPU6 A0A077ZDQ7 A0A080FNV8 A0A080ICJ3 A0A090NBT2 A0A0A0F7R2 A0A0A8UG68 A0A0E0U5K5 A0A0E0VC08 A0A0E0Y7W4 A0A0E1M5N5 A0A0E1T2T1 A0A0E2TM93 A0A0F6CB86 A0A0F6FEM8 A0A0G3K9D6 A0A0H3ERU8 A0A0H3MJI8 A0A0H3PRZ9 A0A0K9T5G5 A0A125WW08 A0A170VZB7 A0A192CF27 A0A1E2VLT1 A0A1H0LGF0 A0A1Q8N187 A0A1S6THT7 A0A1X3HZU7 A0A1X3IEN5 A0A1X3J9W0 A0A1X3KW93 A0A1X3LAQ7 A0A1X3LPD2 A0A1Z3UX79 A0A222QSW7 A0A237FH02 A0A2A2XQJ6 A0A2D0P0P3 A0A2H1BJA1 A0A2I8C7L0 A7ZTX2 B1LLU5 B2TU21 B3X5G6 B6I4A7 B7L8B1 B7LU83 B7NF77 B7UMM7 C3SKV7 C8UJF3 D3H3Y0 D3QX64 D6I327 D6IG05 D6JH89 D7XDF5 D7XM70 D7YBW1 D7ZDN6 D8ADZ2 D8EF11 E0J421 E1J5T0 E2X565 E3PNW1 E3XW44 E6BNJ0 E7SH96 E7T4P3 E7TCN5 E9TN00 E9XUF0 E9Z163 F3WQ21 F4SRH5 F4T619 F4TML6 F4V895 F4VL93 G0F677 H4III4 H4IZG5 H4JFJ2 H4KPC6 H4LJK0 I2RD68 I2RVL7 I2SQA6 I2UCP3 I2WCC3 I2X441 I4S291 I6CYB6 I6DJI2 I6FI91 J7RYM1 K0WRA7 K4V4Q7 K4XKD0 L2X576 L3C0Y6 L3NR76 L3PWH1 L3Q9I8 L4IVU4 L4V0Z9 M9G157 P0AB80 P0AB81 P0AB82 Q31UL4 Q329U9 S0VKI8 S0XEM2 S0Y8I8 S1BX87 S1CSQ5 S1E833 S1H102 S1I1S3 S1IHL1 S1LC57 S1NVC9 T5TZY1 T5ZJU3 T6LR10 T8ZP20 T9DBV4 U9Y3A2 U9YEE9 U9Z197 U9ZK18 V0A9M9 V0SM75 V0VS02 V0YHL7 V0YMF0 V2T0L0 V6FQS6 V8FH73 V8KDJ2 W1F5W9 W1XBY6 W8ZR83
gi|260870496|ref|YP_003236898.1| gi|291285186|ref|YP_003502004.1| gi|218551003|ref|YP_002384794.1| gi|209921244|ref|YP_002295328.1| gi|15833958|ref|NP_312731.1| gi|386707039|ref|YP_006170886.1| gi|407484499|ref|YP_006781649.1| gi|222158469|ref|YP_002558608.1| gi|387509220|ref|YP_006161476.1| gi|26250510|ref|NP_756550.1| gi|82779048|ref|YP_405397.1| gi|187732296|ref|YP_001882404.1| gi|82546125|ref|YP_410072.1| gi|170022201|ref|YP_001727155.1| gi|218556333|ref|YP_002389247.1| gi|386621445|ref|YP_006141025.1| gi|238902853|ref|YP_002928649.1| gi|443619844|ref|YP_007383700.1| gi|15804361|ref|NP_290401.1| gi|254795769|ref|YP_003080606.1| gi|388479476|ref|YP_491668.1| gi|260857823|ref|YP_003231714.1| gi|387614474|ref|YP_006117590.1| gi|49176403|ref|YP_026247.1| gi|378715309|ref|YP_005280202.1| NP_312731.1.58667 WP_000208520.1.1000 WP_000208520.1.10001 WP_000208520.1.100014 WP_000208520.1.100044 WP_000208520.1.100052 WP_000208520.1.100066 WP_000208520.1.100073 WP_000208520.1.100085 WP_000208520.1.10010 WP_000208520.1.100111 WP_000208520.1.100116 WP_000208520.1.100138 WP_000208520.1.100159 WP_000208520.1.100185 WP_000208520.1.100194 WP_000208520.1.100220 WP_000208520.1.100227 WP_000208520.1.100251 WP_000208520.1.100281 WP_000208520.1.100285 WP_000208520.1.100299 WP_000208520.1.100302 WP_000208520.1.100304 WP_000208520.1.100306 WP_000208520.1.10034 WP_000208520.1.100346 WP_000208520.1.100425 WP_000208520.1.100441 WP_000208520.1.100444 WP_000208520.1.100447 WP_000208520.1.100451 WP_000208520.1.100474 WP_000208520.1.100487 WP_000208520.1.100496 WP_000208520.1.100499 WP_000208520.1.100508 WP_000208520.1.10051 WP_000208520.1.100531 WP_000208520.1.100543 WP_000208520.1.100554 WP_000208520.1.100573 WP_000208520.1.100614 WP_000208520.1.100667 WP_000208520.1.10068 WP_000208520.1.100685 WP_000208520.1.100689 WP_000208520.1.100718 WP_000208520.1.100752 WP_000208520.1.100753 WP_000208520.1.100758 WP_000208520.1.100796 WP_000208520.1.10080 WP_000208520.1.100803 WP_000208520.1.100824 WP_000208520.1.100836 WP_000208520.1.10086 WP_000208520.1.100867 WP_000208520.1.100868 WP_000208520.1.100916 WP_000208520.1.100925 WP_000208520.1.100933 WP_000208520.1.10094 WP_000208520.1.100950 WP_000208520.1.100966 WP_000208520.1.100990 WP_000208520.1.10100 WP_000208520.1.101033 WP_000208520.1.101052 WP_000208520.1.101087 WP_000208520.1.101096 WP_000208520.1.1011 WP_000208520.1.101102 WP_000208520.1.101105 WP_000208520.1.101110 WP_000208520.1.101148 WP_000208520.1.101152 WP_000208520.1.101157 WP_000208520.1.101158 WP_000208520.1.101166 WP_000208520.1.101186 WP_000208520.1.101206 WP_000208520.1.101216 WP_000208520.1.101255 WP_000208520.1.10126 WP_000208520.1.101282 WP_000208520.1.101293 WP_000208520.1.10131 WP_000208520.1.101359 WP_000208520.1.101399 WP_000208520.1.101418 WP_000208520.1.101423 WP_000208520.1.101429 WP_000208520.1.101430 WP_000208520.1.101436 WP_000208520.1.101439 WP_000208520.1.101445 WP_000208520.1.101468 WP_000208520.1.101518 WP_000208520.1.10154 WP_000208520.1.101583 WP_000208520.1.101586 WP_000208520.1.101628 WP_000208520.1.101630 WP_000208520.1.101651 WP_000208520.1.101653 WP_000208520.1.101654 WP_000208520.1.101668 WP_000208520.1.101686 WP_000208520.1.101693 WP_000208520.1.101694 WP_000208520.1.101700 WP_000208520.1.101727 WP_000208520.1.10173 WP_000208520.1.101737 WP_000208520.1.101747 WP_000208520.1.101769 WP_000208520.1.101777 WP_000208520.1.101786 WP_000208520.1.10181 WP_000208520.1.101822 WP_000208520.1.10184 WP_000208520.1.101840 WP_000208520.1.101845 WP_000208520.1.101855 WP_000208520.1.10187 WP_000208520.1.10188 WP_000208520.1.10190 WP_000208520.1.101900 WP_000208520.1.101908 WP_000208520.1.101913 WP_000208520.1.101932 WP_000208520.1.101935 WP_000208520.1.101947 WP_000208520.1.101948 WP_000208520.1.101952 WP_000208520.1.101962 WP_000208520.1.101964 WP_000208520.1.101969 WP_000208520.1.101984 WP_000208520.1.101987 WP_000208520.1.102036 WP_000208520.1.10206 WP_000208520.1.102069 WP_000208520.1.102076 WP_000208520.1.102104 WP_000208520.1.102106 WP_000208520.1.102122 WP_000208520.1.102139 WP_000208520.1.10233 WP_000208520.1.10235 WP_000208520.1.10252 WP_000208520.1.10273 WP_000208520.1.10304 WP_000208520.1.10335 WP_000208520.1.10381 WP_000208520.1.1040 WP_000208520.1.10400 WP_000208520.1.10417 WP_000208520.1.10461 WP_000208520.1.10476 WP_000208520.1.10491 WP_000208520.1.10496 WP_000208520.1.10524 WP_000208520.1.10538 WP_000208520.1.10569 WP_000208520.1.10573 WP_000208520.1.10579 WP_000208520.1.10605 WP_000208520.1.10607 WP_000208520.1.10651 WP_000208520.1.10673 WP_000208520.1.10705 WP_000208520.1.1071 WP_000208520.1.10729 WP_000208520.1.10744 WP_000208520.1.10748 WP_000208520.1.10761 WP_000208520.1.10763 WP_000208520.1.10786 WP_000208520.1.10787 WP_000208520.1.10798 WP_000208520.1.10809 WP_000208520.1.10814 WP_000208520.1.10824 WP_000208520.1.10833 WP_000208520.1.10842 WP_000208520.1.10849 WP_000208520.1.10869 WP_000208520.1.10922 WP_000208520.1.10970 WP_000208520.1.10988 WP_000208520.1.10989 WP_000208520.1.10994 WP_000208520.1.11032 WP_000208520.1.11047 WP_000208520.1.11052 WP_000208520.1.11068 WP_000208520.1.11071 WP_000208520.1.11091 WP_000208520.1.1111 WP_000208520.1.11118 WP_000208520.1.1113 WP_000208520.1.11133 WP_000208520.1.112 WP_000208520.1.1122 WP_000208520.1.11240 WP_000208520.1.11241 WP_000208520.1.11265 WP_000208520.1.11285 WP_000208520.1.11296 WP_000208520.1.11301 WP_000208520.1.11315 WP_000208520.1.11408 WP_000208520.1.11411 WP_000208520.1.11418 WP_000208520.1.11420 WP_000208520.1.11436 WP_000208520.1.11437 WP_000208520.1.11467 WP_000208520.1.11519 WP_000208520.1.11524 WP_000208520.1.11542 WP_000208520.1.11575 WP_000208520.1.11578 WP_000208520.1.11607 WP_000208520.1.11612 WP_000208520.1.11616 WP_000208520.1.11645 WP_000208520.1.11671 WP_000208520.1.1168 WP_000208520.1.11699 WP_000208520.1.11759 WP_000208520.1.11801 WP_000208520.1.11803 WP_000208520.1.11844 WP_000208520.1.1186 WP_000208520.1.11949 WP_000208520.1.11955 WP_000208520.1.11956 WP_000208520.1.1196 WP_000208520.1.11981 WP_000208520.1.11982 WP_000208520.1.11985 WP_000208520.1.12030 WP_000208520.1.12036 WP_000208520.1.12050 WP_000208520.1.12051 WP_000208520.1.12088 WP_000208520.1.12111 WP_000208520.1.12115 WP_000208520.1.1212 WP_000208520.1.12151 WP_000208520.1.12157 WP_000208520.1.12174 WP_000208520.1.12230 WP_000208520.1.12259 WP_000208520.1.12268 WP_000208520.1.12295 WP_000208520.1.12305 WP_000208520.1.12319 WP_000208520.1.12320 WP_000208520.1.12342 WP_000208520.1.12344 WP_000208520.1.12352 WP_000208520.1.12415 WP_000208520.1.1242 WP_000208520.1.12458 WP_000208520.1.12459 WP_000208520.1.12468 WP_000208520.1.12478 WP_000208520.1.12542 WP_000208520.1.12552 WP_000208520.1.12558 WP_000208520.1.12566 WP_000208520.1.12574 WP_000208520.1.12582 WP_000208520.1.12594 WP_000208520.1.12623 WP_000208520.1.12645 WP_000208520.1.12646 WP_000208520.1.12679 WP_000208520.1.12680 WP_000208520.1.12693 WP_000208520.1.12697 WP_000208520.1.127 WP_000208520.1.12717 WP_000208520.1.12743 WP_000208520.1.12749 WP_000208520.1.1275 WP_000208520.1.12756 WP_000208520.1.12762 WP_000208520.1.12766 WP_000208520.1.12775 WP_000208520.1.1278 WP_000208520.1.12781 WP_000208520.1.12826 WP_000208520.1.12830 WP_000208520.1.12831 WP_000208520.1.12876 WP_000208520.1.12893 WP_000208520.1.12911 WP_000208520.1.12914 WP_000208520.1.12917 WP_000208520.1.12944 WP_000208520.1.1295 WP_000208520.1.12956 WP_000208520.1.12976 WP_000208520.1.12979 WP_000208520.1.12987 WP_000208520.1.12991 WP_000208520.1.13015 WP_000208520.1.13031 WP_000208520.1.13060 WP_000208520.1.13074 WP_000208520.1.1308 WP_000208520.1.13117 WP_000208520.1.1312 WP_000208520.1.13136 WP_000208520.1.1314 WP_000208520.1.13144 WP_000208520.1.13176 WP_000208520.1.13181 WP_000208520.1.13205 WP_000208520.1.13217 WP_000208520.1.13222 WP_000208520.1.13223 WP_000208520.1.13239 WP_000208520.1.13252 WP_000208520.1.13258 WP_000208520.1.13271 WP_000208520.1.13272 WP_000208520.1.13278 WP_000208520.1.13281 WP_000208520.1.13290 WP_000208520.1.13295 WP_000208520.1.13301 WP_000208520.1.13332 WP_000208520.1.13333 WP_000208520.1.13348 WP_000208520.1.13393 WP_000208520.1.13409 WP_000208520.1.1343 WP_000208520.1.13430 WP_000208520.1.13442 WP_000208520.1.13451 WP_000208520.1.13469 WP_000208520.1.13473 WP_000208520.1.13481 WP_000208520.1.13492 WP_000208520.1.13525 WP_000208520.1.13585 WP_000208520.1.13601 WP_000208520.1.13608 WP_000208520.1.13618 WP_000208520.1.13624 WP_000208520.1.13626 WP_000208520.1.13644 WP_000208520.1.13656 WP_000208520.1.13662 WP_000208520.1.13664 WP_000208520.1.13778 WP_000208520.1.13791 WP_000208520.1.13798 WP_000208520.1.13824 WP_000208520.1.13867 WP_000208520.1.13877 WP_000208520.1.13881 WP_000208520.1.13924 WP_000208520.1.13934 WP_000208520.1.13936 WP_000208520.1.13939 WP_000208520.1.13944 WP_000208520.1.13949 WP_000208520.1.13974 WP_000208520.1.14023 WP_000208520.1.14030 WP_000208520.1.14042 WP_000208520.1.14058 WP_000208520.1.14062 WP_000208520.1.14070 WP_000208520.1.14110 WP_000208520.1.14129 WP_000208520.1.14199 WP_000208520.1.14245 WP_000208520.1.14253 WP_000208520.1.14277 WP_000208520.1.14292 WP_000208520.1.14304 WP_000208520.1.14322 WP_000208520.1.14346 WP_000208520.1.14371 WP_000208520.1.1438 WP_000208520.1.14389 WP_000208520.1.14398 WP_000208520.1.14432 WP_000208520.1.14445 WP_000208520.1.14453 WP_000208520.1.14501 WP_000208520.1.14506 WP_000208520.1.14508 WP_000208520.1.14529 WP_000208520.1.14536 WP_000208520.1.14581 WP_000208520.1.14582 WP_000208520.1.14601 WP_000208520.1.14605 WP_000208520.1.14607 WP_000208520.1.1461 WP_000208520.1.14616 WP_000208520.1.14621 WP_000208520.1.14661 WP_000208520.1.14678 WP_000208520.1.14687 WP_000208520.1.14693 WP_000208520.1.1470 WP_000208520.1.14746 WP_000208520.1.14748 WP_000208520.1.14749 WP_000208520.1.14807 WP_000208520.1.14811 WP_000208520.1.14833 WP_000208520.1.14871 WP_000208520.1.14879 WP_000208520.1.14914 WP_000208520.1.14934 WP_000208520.1.14935 WP_000208520.1.14946 WP_000208520.1.14956 WP_000208520.1.14963 WP_000208520.1.14977 WP_000208520.1.14992 WP_000208520.1.15041 WP_000208520.1.15090 WP_000208520.1.1510 WP_000208520.1.15117 WP_000208520.1.1512 WP_000208520.1.15121 WP_000208520.1.15138 WP_000208520.1.15177 WP_000208520.1.15193 WP_000208520.1.15207 WP_000208520.1.15221 WP_000208520.1.1524 WP_000208520.1.15259 WP_000208520.1.15270 WP_000208520.1.15277 WP_000208520.1.15282 WP_000208520.1.15290 WP_000208520.1.153 WP_000208520.1.15304 WP_000208520.1.15332 WP_000208520.1.15335 WP_000208520.1.15347 WP_000208520.1.15356 WP_000208520.1.15377 WP_000208520.1.15416 WP_000208520.1.15420 WP_000208520.1.1543 WP_000208520.1.15444 WP_000208520.1.15453 WP_000208520.1.15469 WP_000208520.1.15496 WP_000208520.1.1550 WP_000208520.1.15503 WP_000208520.1.15521 WP_000208520.1.15527 WP_000208520.1.15528 WP_000208520.1.15538 WP_000208520.1.15576 WP_000208520.1.15583 WP_000208520.1.15593 WP_000208520.1.15600 WP_000208520.1.1561 WP_000208520.1.15620 WP_000208520.1.15624 WP_000208520.1.15626 WP_000208520.1.15645 WP_000208520.1.15654 WP_000208520.1.15702 WP_000208520.1.15707 WP_000208520.1.15740 WP_000208520.1.15747 WP_000208520.1.15752 WP_000208520.1.15767 WP_000208520.1.15768 WP_000208520.1.15782 WP_000208520.1.15791 WP_000208520.1.15809 WP_000208520.1.1582 WP_000208520.1.15855 WP_000208520.1.15863 WP_000208520.1.15869 WP_000208520.1.1588 WP_000208520.1.15906 WP_000208520.1.15916 WP_000208520.1.15945 WP_000208520.1.15949 WP_000208520.1.15951 WP_000208520.1.15990 WP_000208520.1.16010 WP_000208520.1.16014 WP_000208520.1.16034 WP_000208520.1.1604 WP_000208520.1.16067 WP_000208520.1.16075 WP_000208520.1.16086 WP_000208520.1.16087 WP_000208520.1.1609 WP_000208520.1.16102 WP_000208520.1.16111 WP_000208520.1.16117 WP_000208520.1.16131 WP_000208520.1.16133 WP_000208520.1.16154 WP_000208520.1.16171 WP_000208520.1.16179 WP_000208520.1.16183 WP_000208520.1.16194 WP_000208520.1.1622 WP_000208520.1.16222 WP_000208520.1.16270 WP_000208520.1.16272 WP_000208520.1.16294 WP_000208520.1.163 WP_000208520.1.16322 WP_000208520.1.1634 WP_000208520.1.16387 WP_000208520.1.16388 WP_000208520.1.16396 WP_000208520.1.1640 WP_000208520.1.16463 WP_000208520.1.16481 WP_000208520.1.16500 WP_000208520.1.16517 WP_000208520.1.16532 WP_000208520.1.16539 WP_000208520.1.16541 WP_000208520.1.1655 WP_000208520.1.16577 WP_000208520.1.16612 WP_000208520.1.16667 WP_000208520.1.16682 WP_000208520.1.16685 WP_000208520.1.16700 WP_000208520.1.16705 WP_000208520.1.16715 WP_000208520.1.16721 WP_000208520.1.1673 WP_000208520.1.16745 WP_000208520.1.16752 WP_000208520.1.16766 WP_000208520.1.16798 WP_000208520.1.16799 WP_000208520.1.16805 WP_000208520.1.16807 WP_000208520.1.16818 WP_000208520.1.16843 WP_000208520.1.16845 WP_000208520.1.16862 WP_000208520.1.16927 WP_000208520.1.16992 WP_000208520.1.17014 WP_000208520.1.17018 WP_000208520.1.17061 WP_000208520.1.17084 WP_000208520.1.17087 WP_000208520.1.1710 WP_000208520.1.17102 WP_000208520.1.17109 WP_000208520.1.17111 WP_000208520.1.17114 WP_000208520.1.17119 WP_000208520.1.17123 WP_000208520.1.17150 WP_000208520.1.17153 WP_000208520.1.17170 WP_000208520.1.17172 WP_000208520.1.17182 WP_000208520.1.17187 WP_000208520.1.17206 WP_000208520.1.17216 WP_000208520.1.17241 WP_000208520.1.17242 WP_000208520.1.17282 WP_000208520.1.17297 WP_000208520.1.1731 WP_000208520.1.17325 WP_000208520.1.17333 WP_000208520.1.17356 WP_000208520.1.17373 WP_000208520.1.17386 WP_000208520.1.17387 WP_000208520.1.17403 WP_000208520.1.17410 WP_000208520.1.17415 WP_000208520.1.17432 WP_000208520.1.17464 WP_000208520.1.17496 WP_000208520.1.17515 WP_000208520.1.17534 WP_000208520.1.1754 WP_000208520.1.1755 WP_000208520.1.17550 WP_000208520.1.17568 WP_000208520.1.17577 WP_000208520.1.17595 WP_000208520.1.17623 WP_000208520.1.1763 WP_000208520.1.17637 WP_000208520.1.1769 WP_000208520.1.17701 WP_000208520.1.1772 WP_000208520.1.17734 WP_000208520.1.17757 WP_000208520.1.17766 WP_000208520.1.17769 WP_000208520.1.17802 WP_000208520.1.17829 WP_000208520.1.17831 WP_000208520.1.17849 WP_000208520.1.17889 WP_000208520.1.17904 WP_000208520.1.17920 WP_000208520.1.17925 WP_000208520.1.17937 WP_000208520.1.17952 WP_000208520.1.17961 WP_000208520.1.17963 WP_000208520.1.17984 WP_000208520.1.18000 WP_000208520.1.18006 WP_000208520.1.18024 WP_000208520.1.18050 WP_000208520.1.18064 WP_000208520.1.18094 WP_000208520.1.18112 WP_000208520.1.18118 WP_000208520.1.18133 WP_000208520.1.18134 WP_000208520.1.18136 WP_000208520.1.18141 WP_000208520.1.18164 WP_000208520.1.18175 WP_000208520.1.1821 WP_000208520.1.18225 WP_000208520.1.18226 WP_000208520.1.18229 WP_000208520.1.18275 WP_000208520.1.18316 WP_000208520.1.18326 WP_000208520.1.18329 WP_000208520.1.18337 WP_000208520.1.18338 WP_000208520.1.1834 WP_000208520.1.18340 WP_000208520.1.18348 WP_000208520.1.18381 WP_000208520.1.18383 WP_000208520.1.18394 WP_000208520.1.18402 WP_000208520.1.18410 WP_000208520.1.18420 WP_000208520.1.18436 WP_000208520.1.18438 WP_000208520.1.1844 WP_000208520.1.18458 WP_000208520.1.18461 WP_000208520.1.18472 WP_000208520.1.18482 WP_000208520.1.18530 WP_000208520.1.18550 WP_000208520.1.18556 WP_000208520.1.18581 WP_000208520.1.1861 WP_000208520.1.18617 WP_000208520.1.1862 WP_000208520.1.18649 WP_000208520.1.18650 WP_000208520.1.18651 WP_000208520.1.18655 WP_000208520.1.18666 WP_000208520.1.1867 WP_000208520.1.18699 WP_000208520.1.18714 WP_000208520.1.18725 WP_000208520.1.18726 WP_000208520.1.1873 WP_000208520.1.18734 WP_000208520.1.18794 WP_000208520.1.18801 WP_000208520.1.1881 WP_000208520.1.18837 WP_000208520.1.18843 WP_000208520.1.18858 WP_000208520.1.18861 WP_000208520.1.18874 WP_000208520.1.18876 WP_000208520.1.18899 WP_000208520.1.18908 WP_000208520.1.18929 WP_000208520.1.18936 WP_000208520.1.1896 WP_000208520.1.18966 WP_000208520.1.18983 WP_000208520.1.18995 WP_000208520.1.19036 WP_000208520.1.19039 WP_000208520.1.1906 WP_000208520.1.19075 WP_000208520.1.1909 WP_000208520.1.19090 WP_000208520.1.191 WP_000208520.1.19100 WP_000208520.1.19114 WP_000208520.1.19129 WP_000208520.1.19140 WP_000208520.1.19147 WP_000208520.1.19150 WP_000208520.1.19153 WP_000208520.1.19171 WP_000208520.1.19205 WP_000208520.1.19206 WP_000208520.1.19245 WP_000208520.1.1925 WP_000208520.1.19276 WP_000208520.1.19277 WP_000208520.1.193 WP_000208520.1.19312 WP_000208520.1.19313 WP_000208520.1.19314 WP_000208520.1.19332 WP_000208520.1.19347 WP_000208520.1.19350 WP_000208520.1.19361 WP_000208520.1.19374 WP_000208520.1.19389 WP_000208520.1.19419 WP_000208520.1.19424 WP_000208520.1.19441 WP_000208520.1.19448 WP_000208520.1.19465 WP_000208520.1.19478 WP_000208520.1.19492 WP_000208520.1.19494 WP_000208520.1.1952 WP_000208520.1.19534 WP_000208520.1.19544 WP_000208520.1.19547 WP_000208520.1.19557 WP_000208520.1.19581 WP_000208520.1.19583 WP_000208520.1.19593 WP_000208520.1.1960 WP_000208520.1.19649 WP_000208520.1.19651 WP_000208520.1.19654 WP_000208520.1.19655 WP_000208520.1.19661 WP_000208520.1.19684 WP_000208520.1.19691 WP_000208520.1.19760 WP_000208520.1.19761 WP_000208520.1.19778 WP_000208520.1.19795 WP_000208520.1.1982 WP_000208520.1.19830 WP_000208520.1.19840 WP_000208520.1.19847 WP_000208520.1.19861 WP_000208520.1.19878 WP_000208520.1.19889 WP_000208520.1.19940 WP_000208520.1.19957 WP_000208520.1.19972 WP_000208520.1.19994 WP_000208520.1.2005 WP_000208520.1.20114 WP_000208520.1.20129 WP_000208520.1.2015 WP_000208520.1.20151 WP_000208520.1.20157 WP_000208520.1.20159 WP_000208520.1.20164 WP_000208520.1.20166 WP_000208520.1.20215 WP_000208520.1.20224 WP_000208520.1.20238 WP_000208520.1.20251 WP_000208520.1.20264 WP_000208520.1.20277 WP_000208520.1.20289 WP_000208520.1.20308 WP_000208520.1.20318 WP_000208520.1.20325 WP_000208520.1.20331 WP_000208520.1.20334 WP_000208520.1.20445 WP_000208520.1.20449 WP_000208520.1.20480 WP_000208520.1.20483 WP_000208520.1.20493 WP_000208520.1.20506 WP_000208520.1.20515 WP_000208520.1.20519 WP_000208520.1.20536 WP_000208520.1.20546 WP_000208520.1.20549 WP_000208520.1.20575 WP_000208520.1.20594 WP_000208520.1.20596 WP_000208520.1.20609 WP_000208520.1.2063 WP_000208520.1.20630 WP_000208520.1.20638 WP_000208520.1.20640 WP_000208520.1.20691 WP_000208520.1.20724 WP_000208520.1.20737 WP_000208520.1.20741 WP_000208520.1.20745 WP_000208520.1.2075 WP_000208520.1.20765 WP_000208520.1.20784 WP_000208520.1.20785 WP_000208520.1.20824 WP_000208520.1.20841 WP_000208520.1.20848 WP_000208520.1.20863 WP_000208520.1.2089 WP_000208520.1.20893 WP_000208520.1.20907 WP_000208520.1.2092 WP_000208520.1.20933 WP_000208520.1.2094 WP_000208520.1.20941 WP_000208520.1.20943 WP_000208520.1.20950 WP_000208520.1.20958 WP_000208520.1.20962 WP_000208520.1.20982 WP_000208520.1.20989 WP_000208520.1.2100 WP_000208520.1.21020 WP_000208520.1.21024 WP_000208520.1.21033 WP_000208520.1.21041 WP_000208520.1.21057 WP_000208520.1.21104 WP_000208520.1.21122 WP_000208520.1.21137 WP_000208520.1.21152 WP_000208520.1.21236 WP_000208520.1.21248 WP_000208520.1.21251 WP_000208520.1.21255 WP_000208520.1.21266 WP_000208520.1.21320 WP_000208520.1.21336 WP_000208520.1.21378 WP_000208520.1.2142 WP_000208520.1.21441 WP_000208520.1.21450 WP_000208520.1.21455 WP_000208520.1.21470 WP_000208520.1.21508 WP_000208520.1.21526 WP_000208520.1.21537 WP_000208520.1.2156 WP_000208520.1.21573 WP_000208520.1.21614 WP_000208520.1.21628 WP_000208520.1.2164 WP_000208520.1.21652 WP_000208520.1.21656 WP_000208520.1.21661 WP_000208520.1.21666 WP_000208520.1.21667 WP_000208520.1.21668 WP_000208520.1.21696 WP_000208520.1.21732 WP_000208520.1.21733 WP_000208520.1.21756 WP_000208520.1.21758 WP_000208520.1.21771 WP_000208520.1.21773 WP_000208520.1.21823 WP_000208520.1.21887 WP_000208520.1.21899 WP_000208520.1.21915 WP_000208520.1.21945 WP_000208520.1.21962 WP_000208520.1.2198 WP_000208520.1.21986 WP_000208520.1.21992 WP_000208520.1.22021 WP_000208520.1.22060 WP_000208520.1.22088 WP_000208520.1.22113 WP_000208520.1.22138 WP_000208520.1.22161 WP_000208520.1.2218 WP_000208520.1.22182 WP_000208520.1.22195 WP_000208520.1.22203 WP_000208520.1.22204 WP_000208520.1.22251 WP_000208520.1.22272 WP_000208520.1.22280 WP_000208520.1.22291 WP_000208520.1.22293 WP_000208520.1.22304 WP_000208520.1.22314 WP_000208520.1.22325 WP_000208520.1.22359 WP_000208520.1.22363 WP_000208520.1.22381 WP_000208520.1.2242 WP_000208520.1.22431 WP_000208520.1.22450 WP_000208520.1.22464 WP_000208520.1.22494 WP_000208520.1.22508 WP_000208520.1.22544 WP_000208520.1.22572 WP_000208520.1.22574 WP_000208520.1.22576 WP_000208520.1.22579 WP_000208520.1.22594 WP_000208520.1.22599 WP_000208520.1.22602 WP_000208520.1.22631 WP_000208520.1.22632 WP_000208520.1.22649 WP_000208520.1.22662 WP_000208520.1.22667 WP_000208520.1.22669 WP_000208520.1.22685 WP_000208520.1.22690 WP_000208520.1.22691 WP_000208520.1.22743 WP_000208520.1.22756 WP_000208520.1.22757 WP_000208520.1.22759 WP_000208520.1.22765 WP_000208520.1.22777 WP_000208520.1.22783 WP_000208520.1.22814 WP_000208520.1.22824 WP_000208520.1.22830 WP_000208520.1.22868 WP_000208520.1.22875 WP_000208520.1.22878 WP_000208520.1.22885 WP_000208520.1.22908 WP_000208520.1.22917 WP_000208520.1.22925 WP_000208520.1.22939 WP_000208520.1.22988 WP_000208520.1.22993 WP_000208520.1.2300 WP_000208520.1.23005 WP_000208520.1.23021 WP_000208520.1.23026 WP_000208520.1.23035 WP_000208520.1.23042 WP_000208520.1.23044 WP_000208520.1.23073 WP_000208520.1.23078 WP_000208520.1.23090 WP_000208520.1.23092 WP_000208520.1.23105 WP_000208520.1.23109 WP_000208520.1.23115 WP_000208520.1.23135 WP_000208520.1.2322 WP_000208520.1.23241 WP_000208520.1.2325 WP_000208520.1.23282 WP_000208520.1.23285 WP_000208520.1.23290 WP_000208520.1.23299 WP_000208520.1.23323 WP_000208520.1.23330 WP_000208520.1.23351 WP_000208520.1.23355 WP_000208520.1.23376 WP_000208520.1.23378 WP_000208520.1.23383 WP_000208520.1.23386 WP_000208520.1.23388 WP_000208520.1.23393 WP_000208520.1.23435 WP_000208520.1.23463 WP_000208520.1.23467 WP_000208520.1.23486 WP_000208520.1.23487 WP_000208520.1.23511 WP_000208520.1.23522 WP_000208520.1.23527 WP_000208520.1.23549 WP_000208520.1.23575 WP_000208520.1.23593 WP_000208520.1.2362 WP_000208520.1.23625 WP_000208520.1.23676 WP_000208520.1.23686 WP_000208520.1.23693 WP_000208520.1.23700 WP_000208520.1.23711 WP_000208520.1.23724 WP_000208520.1.23741 WP_000208520.1.23752 WP_000208520.1.23754 WP_000208520.1.23765 WP_000208520.1.23790 WP_000208520.1.23804 WP_000208520.1.23806 WP_000208520.1.23812 WP_000208520.1.23838 WP_000208520.1.23840 WP_000208520.1.23855 WP_000208520.1.23869 WP_000208520.1.2388 WP_000208520.1.23890 WP_000208520.1.23895 WP_000208520.1.23898 WP_000208520.1.23899 WP_000208520.1.23915 WP_000208520.1.23945 WP_000208520.1.23950 WP_000208520.1.23953 WP_000208520.1.23960 WP_000208520.1.23970 WP_000208520.1.23973 WP_000208520.1.23984 WP_000208520.1.23985 WP_000208520.1.24004 WP_000208520.1.24024 WP_000208520.1.24045 WP_000208520.1.24068 WP_000208520.1.24070 WP_000208520.1.24088 WP_000208520.1.24089 WP_000208520.1.24122 WP_000208520.1.24124 WP_000208520.1.24127 WP_000208520.1.2413 WP_000208520.1.24136 WP_000208520.1.24170 WP_000208520.1.24177 WP_000208520.1.2418 WP_000208520.1.24233 WP_000208520.1.2428 WP_000208520.1.24283 WP_000208520.1.2430 WP_000208520.1.24304 WP_000208520.1.24341 WP_000208520.1.24362 WP_000208520.1.24374 WP_000208520.1.24381 WP_000208520.1.24458 WP_000208520.1.24460 WP_000208520.1.24473 WP_000208520.1.24483 WP_000208520.1.2449 WP_000208520.1.24499 WP_000208520.1.24523 WP_000208520.1.24524 WP_000208520.1.24536 WP_000208520.1.24575 WP_000208520.1.24577 WP_000208520.1.24583 WP_000208520.1.24592 WP_000208520.1.24616 WP_000208520.1.24634 WP_000208520.1.24641 WP_000208520.1.24646 WP_000208520.1.2469 WP_000208520.1.24693 WP_000208520.1.24695 WP_000208520.1.24703 WP_000208520.1.24752 WP_000208520.1.24753 WP_000208520.1.24758 WP_000208520.1.24763 WP_000208520.1.24773 WP_000208520.1.24797 WP_000208520.1.24808 WP_000208520.1.24849 WP_000208520.1.24854 WP_000208520.1.24870 WP_000208520.1.24876 WP_000208520.1.24899 WP_000208520.1.24906 WP_000208520.1.24909 WP_000208520.1.24926 WP_000208520.1.24929 WP_000208520.1.24939 WP_000208520.1.24946 WP_000208520.1.24968 WP_000208520.1.24979 WP_000208520.1.24984 WP_000208520.1.25019 WP_000208520.1.2502 WP_000208520.1.25039 WP_000208520.1.2504 WP_000208520.1.25042 WP_000208520.1.25050 WP_000208520.1.25076 WP_000208520.1.25082 WP_000208520.1.25085 WP_000208520.1.25086 WP_000208520.1.25087 WP_000208520.1.25088 WP_000208520.1.25126 WP_000208520.1.25141 WP_000208520.1.25183 WP_000208520.1.25193 WP_000208520.1.25201 WP_000208520.1.25203 WP_000208520.1.25204 WP_000208520.1.25248 WP_000208520.1.25272 WP_000208520.1.25305 WP_000208520.1.2531 WP_000208520.1.25324 WP_000208520.1.25372 WP_000208520.1.25378 WP_000208520.1.25380 WP_000208520.1.2540 WP_000208520.1.25420 WP_000208520.1.2543 WP_000208520.1.25446 WP_000208520.1.25480 WP_000208520.1.25525 WP_000208520.1.25526 WP_000208520.1.25577 WP_000208520.1.2558 WP_000208520.1.25592 WP_000208520.1.25612 WP_000208520.1.25613 WP_000208520.1.25631 WP_000208520.1.25643 WP_000208520.1.2567 WP_000208520.1.25680 WP_000208520.1.25681 WP_000208520.1.25701 WP_000208520.1.25713 WP_000208520.1.25724 WP_000208520.1.25726 WP_000208520.1.25750 WP_000208520.1.25755 WP_000208520.1.25794 WP_000208520.1.25819 WP_000208520.1.25831 WP_000208520.1.25832 WP_000208520.1.25843 WP_000208520.1.25869 WP_000208520.1.25873 WP_000208520.1.2588 WP_000208520.1.25886 WP_000208520.1.25890 WP_000208520.1.25895 WP_000208520.1.25945 WP_000208520.1.2597 WP_000208520.1.25996 WP_000208520.1.26040 WP_000208520.1.26048 WP_000208520.1.26055 WP_000208520.1.26066 WP_000208520.1.26076 WP_000208520.1.26100 WP_000208520.1.26105 WP_000208520.1.26121 WP_000208520.1.26125 WP_000208520.1.26130 WP_000208520.1.26131 WP_000208520.1.26134 WP_000208520.1.26150 WP_000208520.1.26161 WP_000208520.1.26175 WP_000208520.1.26186 WP_000208520.1.26189 WP_000208520.1.26191 WP_000208520.1.26196 WP_000208520.1.26246 WP_000208520.1.26259 WP_000208520.1.26262 WP_000208520.1.26264 WP_000208520.1.26270 WP_000208520.1.26284 WP_000208520.1.26304 WP_000208520.1.26325 WP_000208520.1.26331 WP_000208520.1.2637 WP_000208520.1.26379 WP_000208520.1.26391 WP_000208520.1.26398 WP_000208520.1.26401 WP_000208520.1.26403 WP_000208520.1.26419 WP_000208520.1.2642 WP_000208520.1.26438 WP_000208520.1.26443 WP_000208520.1.26474 WP_000208520.1.26479 WP_000208520.1.26480 WP_000208520.1.26517 WP_000208520.1.26525 WP_000208520.1.26569 WP_000208520.1.26574 WP_000208520.1.26579 WP_000208520.1.26588 WP_000208520.1.26590 WP_000208520.1.26598 WP_000208520.1.26609 WP_000208520.1.26613 WP_000208520.1.26644 WP_000208520.1.2665 WP_000208520.1.26658 WP_000208520.1.26660 WP_000208520.1.26683 WP_000208520.1.26688 WP_000208520.1.26716 WP_000208520.1.26720 WP_000208520.1.26736 WP_000208520.1.26761 WP_000208520.1.26837 WP_000208520.1.26839 WP_000208520.1.26878 WP_000208520.1.2688 WP_000208520.1.26912 WP_000208520.1.26932 WP_000208520.1.2694 WP_000208520.1.26941 WP_000208520.1.26943 WP_000208520.1.2695 WP_000208520.1.26950 WP_000208520.1.26975 WP_000208520.1.26987 WP_000208520.1.26995 WP_000208520.1.26998 WP_000208520.1.2700 WP_000208520.1.27019 WP_000208520.1.27043 WP_000208520.1.27057 WP_000208520.1.27060 WP_000208520.1.27091 WP_000208520.1.27101 WP_000208520.1.2712 WP_000208520.1.27134 WP_000208520.1.27141 WP_000208520.1.27148 WP_000208520.1.27175 WP_000208520.1.27188 WP_000208520.1.27214 WP_000208520.1.27280 WP_000208520.1.27283 WP_000208520.1.27292 WP_000208520.1.2731 WP_000208520.1.27310 WP_000208520.1.27313 WP_000208520.1.27338 WP_000208520.1.27367 WP_000208520.1.27373 WP_000208520.1.27396 WP_000208520.1.27401 WP_000208520.1.27424 WP_000208520.1.27426 WP_000208520.1.27445 WP_000208520.1.27451 WP_000208520.1.27504 WP_000208520.1.27518 WP_000208520.1.27520 WP_000208520.1.2755 WP_000208520.1.27560 WP_000208520.1.27580 WP_000208520.1.27585 WP_000208520.1.27618 WP_000208520.1.27691 WP_000208520.1.27693 WP_000208520.1.27698 WP_000208520.1.27734 WP_000208520.1.27741 WP_000208520.1.27758 WP_000208520.1.27774 WP_000208520.1.2779 WP_000208520.1.27797 WP_000208520.1.2782 WP_000208520.1.27846 WP_000208520.1.27856 WP_000208520.1.27871 WP_000208520.1.27876 WP_000208520.1.27879 WP_000208520.1.27897 WP_000208520.1.27913 WP_000208520.1.27923 WP_000208520.1.27971 WP_000208520.1.27998 WP_000208520.1.28008 WP_000208520.1.28026 WP_000208520.1.28027 WP_000208520.1.28046 WP_000208520.1.28102 WP_000208520.1.28109 WP_000208520.1.2811 WP_000208520.1.28110 WP_000208520.1.28128 WP_000208520.1.28143 WP_000208520.1.28145 WP_000208520.1.28156 WP_000208520.1.28167 WP_000208520.1.28184 WP_000208520.1.28199 WP_000208520.1.2823 WP_000208520.1.28250 WP_000208520.1.2826 WP_000208520.1.28268 WP_000208520.1.28271 WP_000208520.1.28305 WP_000208520.1.28314 WP_000208520.1.28318 WP_000208520.1.28322 WP_000208520.1.28345 WP_000208520.1.28349 WP_000208520.1.28371 WP_000208520.1.2838 WP_000208520.1.28401 WP_000208520.1.28461 WP_000208520.1.28476 WP_000208520.1.28480 WP_000208520.1.28496 WP_000208520.1.28509 WP_000208520.1.28523 WP_000208520.1.28536 WP_000208520.1.28551 WP_000208520.1.28568 WP_000208520.1.28639 WP_000208520.1.2866 WP_000208520.1.28662 WP_000208520.1.28683 WP_000208520.1.28697 WP_000208520.1.28711 WP_000208520.1.28723 WP_000208520.1.28734 WP_000208520.1.28742 WP_000208520.1.28760 WP_000208520.1.28809 WP_000208520.1.2881 WP_000208520.1.28829 WP_000208520.1.28879 WP_000208520.1.28919 WP_000208520.1.28924 WP_000208520.1.28950 WP_000208520.1.28953 WP_000208520.1.28982 WP_000208520.1.28994 WP_000208520.1.290 WP_000208520.1.29001 WP_000208520.1.29013 WP_000208520.1.29016 WP_000208520.1.29026 WP_000208520.1.29049 WP_000208520.1.29055 WP_000208520.1.29061 WP_000208520.1.29082 WP_000208520.1.291 WP_000208520.1.29100 WP_000208520.1.29118 WP_000208520.1.29125 WP_000208520.1.29126 WP_000208520.1.29128 WP_000208520.1.29150 WP_000208520.1.29164 WP_000208520.1.29176 WP_000208520.1.29194 WP_000208520.1.29202 WP_000208520.1.29206 WP_000208520.1.29221 WP_000208520.1.29230 WP_000208520.1.29239 WP_000208520.1.29258 WP_000208520.1.2926 WP_000208520.1.29341 WP_000208520.1.29377 WP_000208520.1.29394 WP_000208520.1.29404 WP_000208520.1.2942 WP_000208520.1.29429 WP_000208520.1.29443 WP_000208520.1.2945 WP_000208520.1.29486 WP_000208520.1.29495 WP_000208520.1.29497 WP_000208520.1.29503 WP_000208520.1.29504 WP_000208520.1.2952 WP_000208520.1.29523 WP_000208520.1.29564 WP_000208520.1.29597 WP_000208520.1.29603 WP_000208520.1.29618 WP_000208520.1.2963 WP_000208520.1.29647 WP_000208520.1.29669 WP_000208520.1.29683 WP_000208520.1.29689 WP_000208520.1.29715 WP_000208520.1.29724 WP_000208520.1.29746 WP_000208520.1.29752 WP_000208520.1.2978 WP_000208520.1.29798 WP_000208520.1.29812 WP_000208520.1.29815 WP_000208520.1.29818 WP_000208520.1.29819 WP_000208520.1.29821 WP_000208520.1.29855 WP_000208520.1.29874 WP_000208520.1.29876 WP_000208520.1.29884 WP_000208520.1.2995 WP_000208520.1.29967 WP_000208520.1.29976 WP_000208520.1.29979 WP_000208520.1.29988 WP_000208520.1.29992 WP_000208520.1.30 WP_000208520.1.30004 WP_000208520.1.30019 WP_000208520.1.30035 WP_000208520.1.30052 WP_000208520.1.30063 WP_000208520.1.30064 WP_000208520.1.30098 WP_000208520.1.30123 WP_000208520.1.30164 WP_000208520.1.3018 WP_000208520.1.30231 WP_000208520.1.30232 WP_000208520.1.30239 WP_000208520.1.30247 WP_000208520.1.30253 WP_000208520.1.30391 WP_000208520.1.30397 WP_000208520.1.30399 WP_000208520.1.30400 WP_000208520.1.30428 WP_000208520.1.3045 WP_000208520.1.30452 WP_000208520.1.30472 WP_000208520.1.30476 WP_000208520.1.30479 WP_000208520.1.30497 WP_000208520.1.30524 WP_000208520.1.30536 WP_000208520.1.30546 WP_000208520.1.3055 WP_000208520.1.30550 WP_000208520.1.30554 WP_000208520.1.306 WP_000208520.1.30630 WP_000208520.1.30637 WP_000208520.1.30639 WP_000208520.1.30665 WP_000208520.1.30691 WP_000208520.1.30733 WP_000208520.1.30742 WP_000208520.1.30749 WP_000208520.1.30762 WP_000208520.1.30808 WP_000208520.1.3083 WP_000208520.1.30843 WP_000208520.1.30853 WP_000208520.1.30866 WP_000208520.1.30867 WP_000208520.1.30879 WP_000208520.1.30887 WP_000208520.1.309 WP_000208520.1.30918 WP_000208520.1.30987 WP_000208520.1.30993 WP_000208520.1.30999 WP_000208520.1.31000 WP_000208520.1.31009 WP_000208520.1.31017 WP_000208520.1.31029 WP_000208520.1.31055 WP_000208520.1.31083 WP_000208520.1.31142 WP_000208520.1.31149 WP_000208520.1.31188 WP_000208520.1.312 WP_000208520.1.31211 WP_000208520.1.31252 WP_000208520.1.31295 WP_000208520.1.31319 WP_000208520.1.31340 WP_000208520.1.31347 WP_000208520.1.31357 WP_000208520.1.31379 WP_000208520.1.3140 WP_000208520.1.31401 WP_000208520.1.31407 WP_000208520.1.31419 WP_000208520.1.31421 WP_000208520.1.31422 WP_000208520.1.31429 WP_000208520.1.31433 WP_000208520.1.3147 WP_000208520.1.31509 WP_000208520.1.31511 WP_000208520.1.31518 WP_000208520.1.31521 WP_000208520.1.31542 WP_000208520.1.31557 WP_000208520.1.31575 WP_000208520.1.31596 WP_000208520.1.31614 WP_000208520.1.31618 WP_000208520.1.31675 WP_000208520.1.3169 WP_000208520.1.31709 WP_000208520.1.31715 WP_000208520.1.31740 WP_000208520.1.31803 WP_000208520.1.31809 WP_000208520.1.3181 WP_000208520.1.31825 WP_000208520.1.31833 WP_000208520.1.31835 WP_000208520.1.31839 WP_000208520.1.31860 WP_000208520.1.31866 WP_000208520.1.31898 WP_000208520.1.31928 WP_000208520.1.3193 WP_000208520.1.31956 WP_000208520.1.31978 WP_000208520.1.3201 WP_000208520.1.32020 WP_000208520.1.32021 WP_000208520.1.3203 WP_000208520.1.32030 WP_000208520.1.32063 WP_000208520.1.32089 WP_000208520.1.32091 WP_000208520.1.32093 WP_000208520.1.32094 WP_000208520.1.3212 WP_000208520.1.32121 WP_000208520.1.32127 WP_000208520.1.32138 WP_000208520.1.32142 WP_000208520.1.32143 WP_000208520.1.3215 WP_000208520.1.322 WP_000208520.1.32222 WP_000208520.1.32225 WP_000208520.1.32232 WP_000208520.1.32234 WP_000208520.1.32236 WP_000208520.1.32243 WP_000208520.1.32287 WP_000208520.1.3233 WP_000208520.1.32394 WP_000208520.1.32432 WP_000208520.1.32443 WP_000208520.1.3247 WP_000208520.1.32475 WP_000208520.1.32478 WP_000208520.1.32479 WP_000208520.1.3248 WP_000208520.1.32480 WP_000208520.1.32494 WP_000208520.1.32509 WP_000208520.1.32518 WP_000208520.1.32536 WP_000208520.1.32558 WP_000208520.1.32561 WP_000208520.1.32574 WP_000208520.1.32587 WP_000208520.1.3259 WP_000208520.1.32590 WP_000208520.1.32591 WP_000208520.1.32650 WP_000208520.1.32655 WP_000208520.1.32661 WP_000208520.1.32676 WP_000208520.1.32680 WP_000208520.1.3269 WP_000208520.1.32709 WP_000208520.1.32722 WP_000208520.1.32724 WP_000208520.1.32748 WP_000208520.1.32772 WP_000208520.1.32811 WP_000208520.1.32831 WP_000208520.1.32835 WP_000208520.1.32875 WP_000208520.1.32888 WP_000208520.1.32903 WP_000208520.1.32910 WP_000208520.1.32931 WP_000208520.1.32938 WP_000208520.1.32946 WP_000208520.1.3295 WP_000208520.1.32959 WP_000208520.1.32972 WP_000208520.1.32984 WP_000208520.1.32992 WP_000208520.1.32995 WP_000208520.1.33004 WP_000208520.1.33014 WP_000208520.1.33018 WP_000208520.1.33022 WP_000208520.1.33026 WP_000208520.1.33046 WP_000208520.1.33049 WP_000208520.1.33055 WP_000208520.1.33094 WP_000208520.1.33101 WP_000208520.1.33125 WP_000208520.1.33146 WP_000208520.1.33167 WP_000208520.1.33178 WP_000208520.1.33179 WP_000208520.1.33222 WP_000208520.1.33238 WP_000208520.1.33244 WP_000208520.1.33268 WP_000208520.1.33303 WP_000208520.1.33325 WP_000208520.1.33341 WP_000208520.1.33352 WP_000208520.1.33369 WP_000208520.1.33385 WP_000208520.1.334 WP_000208520.1.33408 WP_000208520.1.33410 WP_000208520.1.33422 WP_000208520.1.33424 WP_000208520.1.33428 WP_000208520.1.3344 WP_000208520.1.33476 WP_000208520.1.33502 WP_000208520.1.33512 WP_000208520.1.33525 WP_000208520.1.33526 WP_000208520.1.3354 WP_000208520.1.33545 WP_000208520.1.33584 WP_000208520.1.33595 WP_000208520.1.33631 WP_000208520.1.33638 WP_000208520.1.33648 WP_000208520.1.33667 WP_000208520.1.33680 WP_000208520.1.33736 WP_000208520.1.33745 WP_000208520.1.33746 WP_000208520.1.33751 WP_000208520.1.33799 WP_000208520.1.33823 WP_000208520.1.33853 WP_000208520.1.33854 WP_000208520.1.33879 WP_000208520.1.33888 WP_000208520.1.33896 WP_000208520.1.33914 WP_000208520.1.33948 WP_000208520.1.33952 WP_000208520.1.33974 WP_000208520.1.3398 WP_000208520.1.33981 WP_000208520.1.3401 WP_000208520.1.34032 WP_000208520.1.34094 WP_000208520.1.3411 WP_000208520.1.34117 WP_000208520.1.34121 WP_000208520.1.34122 WP_000208520.1.34124 WP_000208520.1.34130 WP_000208520.1.34144 WP_000208520.1.342 WP_000208520.1.34204 WP_000208520.1.34208 WP_000208520.1.34224 WP_000208520.1.34269 WP_000208520.1.34270 WP_000208520.1.34273 WP_000208520.1.34277 WP_000208520.1.34332 WP_000208520.1.34341 WP_000208520.1.34348 WP_000208520.1.34362 WP_000208520.1.34363 WP_000208520.1.34383 WP_000208520.1.3439 WP_000208520.1.34397 WP_000208520.1.34400 WP_000208520.1.34422 WP_000208520.1.3444 WP_000208520.1.34441 WP_000208520.1.34444 WP_000208520.1.34456 WP_000208520.1.34464 WP_000208520.1.34470 WP_000208520.1.34500 WP_000208520.1.34525 WP_000208520.1.34528 WP_000208520.1.34532 WP_000208520.1.34538 WP_000208520.1.34558 WP_000208520.1.3460 WP_000208520.1.34605 WP_000208520.1.34617 WP_000208520.1.34675 WP_000208520.1.34680 WP_000208520.1.34682 WP_000208520.1.34686 WP_000208520.1.3469 WP_000208520.1.347 WP_000208520.1.3472 WP_000208520.1.34763 WP_000208520.1.34781 WP_000208520.1.34782 WP_000208520.1.34794 WP_000208520.1.34838 WP_000208520.1.34855 WP_000208520.1.34875 WP_000208520.1.34887 WP_000208520.1.34931 WP_000208520.1.34948 WP_000208520.1.34966 WP_000208520.1.34982 WP_000208520.1.34990 WP_000208520.1.34993 WP_000208520.1.35003 WP_000208520.1.35006 WP_000208520.1.35007 WP_000208520.1.35012 WP_000208520.1.35039 WP_000208520.1.35107 WP_000208520.1.35114 WP_000208520.1.35132 WP_000208520.1.3515 WP_000208520.1.35168 WP_000208520.1.35180 WP_000208520.1.35195 WP_000208520.1.35198 WP_000208520.1.35202 WP_000208520.1.35204 WP_000208520.1.35211 WP_000208520.1.35220 WP_000208520.1.35258 WP_000208520.1.35316 WP_000208520.1.35349 WP_000208520.1.35360 WP_000208520.1.35365 WP_000208520.1.35376 WP_000208520.1.3539 WP_000208520.1.35393 WP_000208520.1.35394 WP_000208520.1.35448 WP_000208520.1.35465 WP_000208520.1.35466 WP_000208520.1.35468 WP_000208520.1.35483 WP_000208520.1.3550 WP_000208520.1.35552 WP_000208520.1.35578 WP_000208520.1.3560 WP_000208520.1.35604 WP_000208520.1.35627 WP_000208520.1.35651 WP_000208520.1.35653 WP_000208520.1.35724 WP_000208520.1.35740 WP_000208520.1.35741 WP_000208520.1.35744 WP_000208520.1.35789 WP_000208520.1.35889 WP_000208520.1.35904 WP_000208520.1.35922 WP_000208520.1.35927 WP_000208520.1.35942 WP_000208520.1.35959 WP_000208520.1.35963 WP_000208520.1.3598 WP_000208520.1.35985 WP_000208520.1.35987 WP_000208520.1.35990 WP_000208520.1.3600 WP_000208520.1.36010 WP_000208520.1.36042 WP_000208520.1.36071 WP_000208520.1.36085 WP_000208520.1.36094 WP_000208520.1.36105 WP_000208520.1.36164 WP_000208520.1.36166 WP_000208520.1.36177 WP_000208520.1.36182 WP_000208520.1.3620 WP_000208520.1.36207 WP_000208520.1.36212 WP_000208520.1.36332 WP_000208520.1.36334 WP_000208520.1.36352 WP_000208520.1.36386 WP_000208520.1.36393 WP_000208520.1.36405 WP_000208520.1.36412 WP_000208520.1.36426 WP_000208520.1.3643 WP_000208520.1.36453 WP_000208520.1.36459 WP_000208520.1.36496 WP_000208520.1.36500 WP_000208520.1.36507 WP_000208520.1.36523 WP_000208520.1.36531 WP_000208520.1.36610 WP_000208520.1.36626 WP_000208520.1.36628 WP_000208520.1.36667 WP_000208520.1.3668 WP_000208520.1.36699 WP_000208520.1.36707 WP_000208520.1.3671 WP_000208520.1.36724 WP_000208520.1.36746 WP_000208520.1.36747 WP_000208520.1.36761 WP_000208520.1.36767 WP_000208520.1.36786 WP_000208520.1.36806 WP_000208520.1.36812 WP_000208520.1.36817 WP_000208520.1.36826 WP_000208520.1.36833 WP_000208520.1.36856 WP_000208520.1.36886 WP_000208520.1.36904 WP_000208520.1.36925 WP_000208520.1.3697 WP_000208520.1.36975 WP_000208520.1.37020 WP_000208520.1.37032 WP_000208520.1.37046 WP_000208520.1.37049 WP_000208520.1.37057 WP_000208520.1.37099 WP_000208520.1.37102 WP_000208520.1.37122 WP_000208520.1.37153 WP_000208520.1.37226 WP_000208520.1.3723 WP_000208520.1.37233 WP_000208520.1.37252 WP_000208520.1.37261 WP_000208520.1.37290 WP_000208520.1.37306 WP_000208520.1.37312 WP_000208520.1.37329 WP_000208520.1.37334 WP_000208520.1.37337 WP_000208520.1.37342 WP_000208520.1.37352 WP_000208520.1.37360 WP_000208520.1.37371 WP_000208520.1.37372 WP_000208520.1.37423 WP_000208520.1.37433 WP_000208520.1.37445 WP_000208520.1.37472 WP_000208520.1.37476 WP_000208520.1.37477 WP_000208520.1.37485 WP_000208520.1.37510 WP_000208520.1.37516 WP_000208520.1.37538 WP_000208520.1.37544 WP_000208520.1.37548 WP_000208520.1.37550 WP_000208520.1.37554 WP_000208520.1.37576 WP_000208520.1.37588 WP_000208520.1.37592 WP_000208520.1.37608 WP_000208520.1.3762 WP_000208520.1.37634 WP_000208520.1.37664 WP_000208520.1.377 WP_000208520.1.3772 WP_000208520.1.37731 WP_000208520.1.37745 WP_000208520.1.37750 WP_000208520.1.37758 WP_000208520.1.37762 WP_000208520.1.37766 WP_000208520.1.37769 WP_000208520.1.37773 WP_000208520.1.37817 WP_000208520.1.37847 WP_000208520.1.37852 WP_000208520.1.37853 WP_000208520.1.3788 WP_000208520.1.37880 WP_000208520.1.37887 WP_000208520.1.37897 WP_000208520.1.37917 WP_000208520.1.37923 WP_000208520.1.37926 WP_000208520.1.3795 WP_000208520.1.3796 WP_000208520.1.37964 WP_000208520.1.37967 WP_000208520.1.37984 WP_000208520.1.37995 WP_000208520.1.37998 WP_000208520.1.38000 WP_000208520.1.38033 WP_000208520.1.38043 WP_000208520.1.38050 WP_000208520.1.38080 WP_000208520.1.38081 WP_000208520.1.38085 WP_000208520.1.38103 WP_000208520.1.38105 WP_000208520.1.38107 WP_000208520.1.3811 WP_000208520.1.38120 WP_000208520.1.3815 WP_000208520.1.38162 WP_000208520.1.38182 WP_000208520.1.38185 WP_000208520.1.3822 WP_000208520.1.38234 WP_000208520.1.38300 WP_000208520.1.38306 WP_000208520.1.38314 WP_000208520.1.38323 WP_000208520.1.38357 WP_000208520.1.38363 WP_000208520.1.38369 WP_000208520.1.38371 WP_000208520.1.38392 WP_000208520.1.38412 WP_000208520.1.38533 WP_000208520.1.38544 WP_000208520.1.38561 WP_000208520.1.38584 WP_000208520.1.38626 WP_000208520.1.38629 WP_000208520.1.38636 WP_000208520.1.38694 WP_000208520.1.3873 WP_000208520.1.38751 WP_000208520.1.38777 WP_000208520.1.38782 WP_000208520.1.38811 WP_000208520.1.38835 WP_000208520.1.38843 WP_000208520.1.38896 WP_000208520.1.389 WP_000208520.1.38911 WP_000208520.1.38920 WP_000208520.1.38935 WP_000208520.1.38937 WP_000208520.1.38950 WP_000208520.1.38958 WP_000208520.1.39005 WP_000208520.1.3904 WP_000208520.1.39103 WP_000208520.1.3912 WP_000208520.1.39123 WP_000208520.1.39148 WP_000208520.1.39150 WP_000208520.1.39164 WP_000208520.1.39171 WP_000208520.1.39180 WP_000208520.1.39184 WP_000208520.1.39196 WP_000208520.1.3922 WP_000208520.1.39232 WP_000208520.1.39249 WP_000208520.1.39254 WP_000208520.1.39268 WP_000208520.1.39289 WP_000208520.1.39302 WP_000208520.1.39310 WP_000208520.1.39313 WP_000208520.1.39325 WP_000208520.1.39335 WP_000208520.1.39342 WP_000208520.1.39356 WP_000208520.1.39365 WP_000208520.1.39367 WP_000208520.1.39377 WP_000208520.1.39401 WP_000208520.1.39402 WP_000208520.1.39415 WP_000208520.1.39481 WP_000208520.1.39492 WP_000208520.1.39509 WP_000208520.1.39531 WP_000208520.1.3954 WP_000208520.1.39541 WP_000208520.1.39564 WP_000208520.1.39575 WP_000208520.1.39601 WP_000208520.1.39606 WP_000208520.1.39607 WP_000208520.1.39610 WP_000208520.1.39626 WP_000208520.1.39636 WP_000208520.1.39646 WP_000208520.1.39651 WP_000208520.1.39690 WP_000208520.1.3970 WP_000208520.1.39708 WP_000208520.1.39709 WP_000208520.1.39713 WP_000208520.1.39726 WP_000208520.1.39733 WP_000208520.1.39734 WP_000208520.1.39758 WP_000208520.1.39796 WP_000208520.1.3980 WP_000208520.1.39809 WP_000208520.1.39820 WP_000208520.1.39822 WP_000208520.1.39829 WP_000208520.1.39867 WP_000208520.1.39870 WP_000208520.1.39892 WP_000208520.1.39938 WP_000208520.1.39961 WP_000208520.1.39966 WP_000208520.1.39970 WP_000208520.1.39973 WP_000208520.1.40 WP_000208520.1.40013 WP_000208520.1.40016 WP_000208520.1.40019 WP_000208520.1.4005 WP_000208520.1.40083 WP_000208520.1.40088 WP_000208520.1.40107 WP_000208520.1.40113 WP_000208520.1.40140 WP_000208520.1.40147 WP_000208520.1.40153 WP_000208520.1.40190 WP_000208520.1.40192 WP_000208520.1.4020 WP_000208520.1.40206 WP_000208520.1.40212 WP_000208520.1.40218 WP_000208520.1.40234 WP_000208520.1.40238 WP_000208520.1.40249 WP_000208520.1.40298 WP_000208520.1.4030 WP_000208520.1.40300 WP_000208520.1.40315 WP_000208520.1.40317 WP_000208520.1.40319 WP_000208520.1.40345 WP_000208520.1.40349 WP_000208520.1.40360 WP_000208520.1.40382 WP_000208520.1.40389 WP_000208520.1.40391 WP_000208520.1.40403 WP_000208520.1.40445 WP_000208520.1.40486 WP_000208520.1.4049 WP_000208520.1.40499 WP_000208520.1.40502 WP_000208520.1.40509 WP_000208520.1.40524 WP_000208520.1.40539 WP_000208520.1.40548 WP_000208520.1.40549 WP_000208520.1.40560 WP_000208520.1.40563 WP_000208520.1.40596 WP_000208520.1.40599 WP_000208520.1.406 WP_000208520.1.40607 WP_000208520.1.40617 WP_000208520.1.40629 WP_000208520.1.40636 WP_000208520.1.40657 WP_000208520.1.40660 WP_000208520.1.40666 WP_000208520.1.40686 WP_000208520.1.40712 WP_000208520.1.40715 WP_000208520.1.40742 WP_000208520.1.40758 WP_000208520.1.40793 WP_000208520.1.40813 WP_000208520.1.40815 WP_000208520.1.4082 WP_000208520.1.40833 WP_000208520.1.40842 WP_000208520.1.40843 WP_000208520.1.40882 WP_000208520.1.40893 WP_000208520.1.40898 WP_000208520.1.40900 WP_000208520.1.40912 WP_000208520.1.40937 WP_000208520.1.40952 WP_000208520.1.40965 WP_000208520.1.4103 WP_000208520.1.41037 WP_000208520.1.41041 WP_000208520.1.41045 WP_000208520.1.41060 WP_000208520.1.41078 WP_000208520.1.41113 WP_000208520.1.41125 WP_000208520.1.41147 WP_000208520.1.41206 WP_000208520.1.41239 WP_000208520.1.4126 WP_000208520.1.41263 WP_000208520.1.41271 WP_000208520.1.41294 WP_000208520.1.41315 WP_000208520.1.41330 WP_000208520.1.41332 WP_000208520.1.41346 WP_000208520.1.41363 WP_000208520.1.41368 WP_000208520.1.41371 WP_000208520.1.41392 WP_000208520.1.41394 WP_000208520.1.41401 WP_000208520.1.41402 WP_000208520.1.41417 WP_000208520.1.4142 WP_000208520.1.41436 WP_000208520.1.41453 WP_000208520.1.41455 WP_000208520.1.41466 WP_000208520.1.41478 WP_000208520.1.41479 WP_000208520.1.41481 WP_000208520.1.41482 WP_000208520.1.41483 WP_000208520.1.41484 WP_000208520.1.41488 WP_000208520.1.41530 WP_000208520.1.41536 WP_000208520.1.41545 WP_000208520.1.41556 WP_000208520.1.41566 WP_000208520.1.4158 WP_000208520.1.41613 WP_000208520.1.41621 WP_000208520.1.41651 WP_000208520.1.41654 WP_000208520.1.41734 WP_000208520.1.41741 WP_000208520.1.41752 WP_000208520.1.41780 WP_000208520.1.41782 WP_000208520.1.41783 WP_000208520.1.41784 WP_000208520.1.41809 WP_000208520.1.41812 WP_000208520.1.41813 WP_000208520.1.41822 WP_000208520.1.41826 WP_000208520.1.41837 WP_000208520.1.41849 WP_000208520.1.41884 WP_000208520.1.41885 WP_000208520.1.41900 WP_000208520.1.4193 WP_000208520.1.41956 WP_000208520.1.41964 WP_000208520.1.41988 WP_000208520.1.41990 WP_000208520.1.41991 WP_000208520.1.42022 WP_000208520.1.42027 WP_000208520.1.42033 WP_000208520.1.42036 WP_000208520.1.42038 WP_000208520.1.42044 WP_000208520.1.42073 WP_000208520.1.42113 WP_000208520.1.4213 WP_000208520.1.42138 WP_000208520.1.4214 WP_000208520.1.42151 WP_000208520.1.42159 WP_000208520.1.42179 WP_000208520.1.42191 WP_000208520.1.42203 WP_000208520.1.42209 WP_000208520.1.42214 WP_000208520.1.42221 WP_000208520.1.42226 WP_000208520.1.42228 WP_000208520.1.4224 WP_000208520.1.42252 WP_000208520.1.42258 WP_000208520.1.42318 WP_000208520.1.42367 WP_000208520.1.42376 WP_000208520.1.42387 WP_000208520.1.42415 WP_000208520.1.4242 WP_000208520.1.42432 WP_000208520.1.42442 WP_000208520.1.42443 WP_000208520.1.42447 WP_000208520.1.42456 WP_000208520.1.4250 WP_000208520.1.42513 WP_000208520.1.42516 WP_000208520.1.42522 WP_000208520.1.42547 WP_000208520.1.42586 WP_000208520.1.42594 WP_000208520.1.42597 WP_000208520.1.42600 WP_000208520.1.42601 WP_000208520.1.4261 WP_000208520.1.42632 WP_000208520.1.42638 WP_000208520.1.42661 WP_000208520.1.42669 WP_000208520.1.42677 WP_000208520.1.42709 WP_000208520.1.42748 WP_000208520.1.42749 WP_000208520.1.42756 WP_000208520.1.42770 WP_000208520.1.42771 WP_000208520.1.42808 WP_000208520.1.42813 WP_000208520.1.4282 WP_000208520.1.42832 WP_000208520.1.42863 WP_000208520.1.42879 WP_000208520.1.42880 WP_000208520.1.42891 WP_000208520.1.4290 WP_000208520.1.42903 WP_000208520.1.42918 WP_000208520.1.42937 WP_000208520.1.42950 WP_000208520.1.42962 WP_000208520.1.42970 WP_000208520.1.42975 WP_000208520.1.42987 WP_000208520.1.42989 WP_000208520.1.43013 WP_000208520.1.43027 WP_000208520.1.43035 WP_000208520.1.4306 WP_000208520.1.43079 WP_000208520.1.43121 WP_000208520.1.43123 WP_000208520.1.4313 WP_000208520.1.43137 WP_000208520.1.43140 WP_000208520.1.43166 WP_000208520.1.43170 WP_000208520.1.43174 WP_000208520.1.43177 WP_000208520.1.43196 WP_000208520.1.43213 WP_000208520.1.43216 WP_000208520.1.43239 WP_000208520.1.43278 WP_000208520.1.43316 WP_000208520.1.4334 WP_000208520.1.43384 WP_000208520.1.43389 WP_000208520.1.4342 WP_000208520.1.43427 WP_000208520.1.4343 WP_000208520.1.43444 WP_000208520.1.43448 WP_000208520.1.43455 WP_000208520.1.43469 WP_000208520.1.43473 WP_000208520.1.43474 WP_000208520.1.43489 WP_000208520.1.43501 WP_000208520.1.43536 WP_000208520.1.4356 WP_000208520.1.43598 WP_000208520.1.436 WP_000208520.1.43604 WP_000208520.1.43622 WP_000208520.1.43720 WP_000208520.1.43738 WP_000208520.1.43750 WP_000208520.1.43754 WP_000208520.1.43769 WP_000208520.1.43798 WP_000208520.1.43804 WP_000208520.1.43816 WP_000208520.1.43837 WP_000208520.1.43858 WP_000208520.1.43898 WP_000208520.1.43911 WP_000208520.1.43918 WP_000208520.1.43925 WP_000208520.1.43939 WP_000208520.1.43942 WP_000208520.1.43953 WP_000208520.1.43966 WP_000208520.1.43989 WP_000208520.1.44018 WP_000208520.1.44020 WP_000208520.1.44029 WP_000208520.1.44040 WP_000208520.1.44051 WP_000208520.1.44077 WP_000208520.1.44088 WP_000208520.1.44096 WP_000208520.1.44100 WP_000208520.1.44115 WP_000208520.1.44125 WP_000208520.1.44130 WP_000208520.1.4415 WP_000208520.1.44162 WP_000208520.1.44165 WP_000208520.1.44166 WP_000208520.1.44201 WP_000208520.1.44203 WP_000208520.1.44211 WP_000208520.1.44238 WP_000208520.1.44263 WP_000208520.1.44273 WP_000208520.1.44285 WP_000208520.1.44292 WP_000208520.1.44324 WP_000208520.1.44327 WP_000208520.1.44354 WP_000208520.1.44365 WP_000208520.1.44389 WP_000208520.1.44394 WP_000208520.1.44422 WP_000208520.1.44445 WP_000208520.1.44452 WP_000208520.1.44458 WP_000208520.1.44488 WP_000208520.1.4449 WP_000208520.1.44524 WP_000208520.1.4454 WP_000208520.1.44558 WP_000208520.1.44561 WP_000208520.1.44570 WP_000208520.1.44587 WP_000208520.1.4459 WP_000208520.1.44608 WP_000208520.1.44610 WP_000208520.1.44622 WP_000208520.1.4463 WP_000208520.1.44642 WP_000208520.1.44649 WP_000208520.1.44661 WP_000208520.1.44668 WP_000208520.1.4471 WP_000208520.1.44717 WP_000208520.1.44724 WP_000208520.1.4473 WP_000208520.1.44733 WP_000208520.1.44756 WP_000208520.1.44759 WP_000208520.1.44784 WP_000208520.1.44800 WP_000208520.1.44821 WP_000208520.1.44836 WP_000208520.1.44840 WP_000208520.1.44841 WP_000208520.1.44849 WP_000208520.1.44854 WP_000208520.1.44855 WP_000208520.1.44857 WP_000208520.1.44906 WP_000208520.1.44923 WP_000208520.1.44954 WP_000208520.1.44960 WP_000208520.1.44970 WP_000208520.1.44975 WP_000208520.1.44977 WP_000208520.1.44980 WP_000208520.1.45020 WP_000208520.1.45025 WP_000208520.1.45043 WP_000208520.1.45053 WP_000208520.1.45076 WP_000208520.1.45104 WP_000208520.1.45116 WP_000208520.1.45153 WP_000208520.1.4516 WP_000208520.1.45190 WP_000208520.1.45195 WP_000208520.1.45208 WP_000208520.1.45246 WP_000208520.1.45293 WP_000208520.1.4530 WP_000208520.1.45301 WP_000208520.1.45313 WP_000208520.1.45329 WP_000208520.1.45359 WP_000208520.1.4538 WP_000208520.1.45404 WP_000208520.1.45405 WP_000208520.1.45440 WP_000208520.1.45444 WP_000208520.1.45486 WP_000208520.1.4549 WP_000208520.1.45525 WP_000208520.1.45538 WP_000208520.1.45565 WP_000208520.1.45575 WP_000208520.1.45581 WP_000208520.1.45595 WP_000208520.1.45627 WP_000208520.1.45664 WP_000208520.1.45674 WP_000208520.1.45676 WP_000208520.1.4570 WP_000208520.1.45707 WP_000208520.1.45718 WP_000208520.1.4574 WP_000208520.1.45740 WP_000208520.1.45741 WP_000208520.1.45752 WP_000208520.1.45789 WP_000208520.1.45793 WP_000208520.1.45801 WP_000208520.1.45806 WP_000208520.1.4583 WP_000208520.1.45840 WP_000208520.1.45841 WP_000208520.1.45846 WP_000208520.1.45868 WP_000208520.1.45891 WP_000208520.1.45901 WP_000208520.1.45921 WP_000208520.1.4593 WP_000208520.1.45931 WP_000208520.1.45933 WP_000208520.1.45941 WP_000208520.1.45960 WP_000208520.1.45968 WP_000208520.1.4600 WP_000208520.1.46026 WP_000208520.1.46039 WP_000208520.1.46048 WP_000208520.1.46049 WP_000208520.1.46070 WP_000208520.1.46081 WP_000208520.1.46097 WP_000208520.1.46105 WP_000208520.1.46115 WP_000208520.1.46122 WP_000208520.1.4613 WP_000208520.1.46164 WP_000208520.1.46186 WP_000208520.1.4619 WP_000208520.1.46197 WP_000208520.1.46213 WP_000208520.1.46217 WP_000208520.1.46239 WP_000208520.1.46257 WP_000208520.1.46282 WP_000208520.1.46283 WP_000208520.1.46291 WP_000208520.1.46301 WP_000208520.1.46325 WP_000208520.1.46329 WP_000208520.1.46369 WP_000208520.1.46379 WP_000208520.1.46414 WP_000208520.1.46433 WP_000208520.1.46438 WP_000208520.1.46441 WP_000208520.1.46451 WP_000208520.1.4646 WP_000208520.1.4647 WP_000208520.1.46477 WP_000208520.1.46487 WP_000208520.1.46503 WP_000208520.1.46526 WP_000208520.1.46531 WP_000208520.1.46552 WP_000208520.1.46555 WP_000208520.1.4657 WP_000208520.1.46582 WP_000208520.1.46589 WP_000208520.1.46594 WP_000208520.1.46597 WP_000208520.1.46611 WP_000208520.1.46614 WP_000208520.1.46616 WP_000208520.1.46626 WP_000208520.1.46643 WP_000208520.1.46668 WP_000208520.1.46743 WP_000208520.1.46795 WP_000208520.1.46802 WP_000208520.1.46806 WP_000208520.1.46810 WP_000208520.1.46820 WP_000208520.1.46821 WP_000208520.1.46832 WP_000208520.1.46841 WP_000208520.1.46860 WP_000208520.1.46876 WP_000208520.1.46882 WP_000208520.1.46898 WP_000208520.1.46909 WP_000208520.1.4691 WP_000208520.1.46912 WP_000208520.1.46913 WP_000208520.1.46932 WP_000208520.1.4695 WP_000208520.1.46990 WP_000208520.1.46991 WP_000208520.1.46994 WP_000208520.1.46999 WP_000208520.1.47028 WP_000208520.1.47029 WP_000208520.1.47034 WP_000208520.1.47038 WP_000208520.1.47047 WP_000208520.1.47048 WP_000208520.1.47050 WP_000208520.1.47063 WP_000208520.1.47069 WP_000208520.1.47073 WP_000208520.1.4708 WP_000208520.1.47124 WP_000208520.1.47140 WP_000208520.1.47156 WP_000208520.1.47167 WP_000208520.1.47171 WP_000208520.1.47186 WP_000208520.1.47189 WP_000208520.1.47197 WP_000208520.1.47198 WP_000208520.1.4722 WP_000208520.1.4723 WP_000208520.1.47235 WP_000208520.1.47247 WP_000208520.1.4725 WP_000208520.1.47280 WP_000208520.1.47307 WP_000208520.1.47319 WP_000208520.1.47322 WP_000208520.1.47332 WP_000208520.1.47344 WP_000208520.1.47349 WP_000208520.1.47356 WP_000208520.1.47363 WP_000208520.1.47366 WP_000208520.1.47370 WP_000208520.1.4740 WP_000208520.1.47411 WP_000208520.1.47414 WP_000208520.1.4743 WP_000208520.1.47454 WP_000208520.1.47473 WP_000208520.1.47477 WP_000208520.1.47488 WP_000208520.1.47496 WP_000208520.1.47498 WP_000208520.1.47500 WP_000208520.1.47529 WP_000208520.1.47533 WP_000208520.1.47546 WP_000208520.1.47599 WP_000208520.1.47634 WP_000208520.1.47646 WP_000208520.1.47654 WP_000208520.1.47662 WP_000208520.1.47673 WP_000208520.1.4772 WP_000208520.1.47722 WP_000208520.1.47734 WP_000208520.1.47740 WP_000208520.1.47744 WP_000208520.1.47761 WP_000208520.1.47765 WP_000208520.1.47770 WP_000208520.1.47784 WP_000208520.1.47790 WP_000208520.1.47791 WP_000208520.1.47820 WP_000208520.1.47827 WP_000208520.1.4783 WP_000208520.1.47848 WP_000208520.1.4785 WP_000208520.1.47884 WP_000208520.1.47935 WP_000208520.1.47954 WP_000208520.1.4796 WP_000208520.1.47962 WP_000208520.1.47994 WP_000208520.1.48000 WP_000208520.1.48018 WP_000208520.1.48029 WP_000208520.1.48040 WP_000208520.1.48048 WP_000208520.1.48051 WP_000208520.1.48065 WP_000208520.1.48073 WP_000208520.1.48077 WP_000208520.1.48090 WP_000208520.1.4811 WP_000208520.1.48111 WP_000208520.1.4812 WP_000208520.1.48144 WP_000208520.1.48168 WP_000208520.1.48176 WP_000208520.1.48188 WP_000208520.1.48194 WP_000208520.1.48200 WP_000208520.1.48203 WP_000208520.1.48216 WP_000208520.1.48222 WP_000208520.1.48226 WP_000208520.1.48229 WP_000208520.1.48258 WP_000208520.1.4826 WP_000208520.1.48290 WP_000208520.1.48291 WP_000208520.1.48317 WP_000208520.1.48353 WP_000208520.1.48355 WP_000208520.1.48371 WP_000208520.1.48385 WP_000208520.1.48421 WP_000208520.1.48431 WP_000208520.1.48433 WP_000208520.1.48469 WP_000208520.1.48477 WP_000208520.1.48480 WP_000208520.1.48483 WP_000208520.1.48505 WP_000208520.1.48522 WP_000208520.1.4857 WP_000208520.1.48571 WP_000208520.1.486 WP_000208520.1.48678 WP_000208520.1.48689 WP_000208520.1.48697 WP_000208520.1.4871 WP_000208520.1.48712 WP_000208520.1.4876 WP_000208520.1.48771 WP_000208520.1.48792 WP_000208520.1.48801 WP_000208520.1.48806 WP_000208520.1.48827 WP_000208520.1.48860 WP_000208520.1.48901 WP_000208520.1.48902 WP_000208520.1.48910 WP_000208520.1.4892 WP_000208520.1.48926 WP_000208520.1.48928 WP_000208520.1.48953 WP_000208520.1.48954 WP_000208520.1.48970 WP_000208520.1.48974 WP_000208520.1.49001 WP_000208520.1.49076 WP_000208520.1.49104 WP_000208520.1.49107 WP_000208520.1.49124 WP_000208520.1.49147 WP_000208520.1.49170 WP_000208520.1.49179 WP_000208520.1.49190 WP_000208520.1.49229 WP_000208520.1.49236 WP_000208520.1.49243 WP_000208520.1.49258 WP_000208520.1.49275 WP_000208520.1.4931 WP_000208520.1.49312 WP_000208520.1.49321 WP_000208520.1.49332 WP_000208520.1.49336 WP_000208520.1.49342 WP_000208520.1.49347 WP_000208520.1.49363 WP_000208520.1.49401 WP_000208520.1.49412 WP_000208520.1.49446 WP_000208520.1.49459 WP_000208520.1.49464 WP_000208520.1.49482 WP_000208520.1.49483 WP_000208520.1.49496 WP_000208520.1.49521 WP_000208520.1.49531 WP_000208520.1.49537 WP_000208520.1.49558 WP_000208520.1.49567 WP_000208520.1.49594 WP_000208520.1.49599 WP_000208520.1.49615 WP_000208520.1.49621 WP_000208520.1.49625 WP_000208520.1.49645 WP_000208520.1.49655 WP_000208520.1.49661 WP_000208520.1.497 WP_000208520.1.49712 WP_000208520.1.49722 WP_000208520.1.49733 WP_000208520.1.49747 WP_000208520.1.49768 WP_000208520.1.49771 WP_000208520.1.49774 WP_000208520.1.49783 WP_000208520.1.49788 WP_000208520.1.49820 WP_000208520.1.49856 WP_000208520.1.49861 WP_000208520.1.49879 WP_000208520.1.49884 WP_000208520.1.49900 WP_000208520.1.49950 WP_000208520.1.49954 WP_000208520.1.49972 WP_000208520.1.49987 WP_000208520.1.50006 WP_000208520.1.50008 WP_000208520.1.5003 WP_000208520.1.50036 WP_000208520.1.50058 WP_000208520.1.50078 WP_000208520.1.50110 WP_000208520.1.50113 WP_000208520.1.50119 WP_000208520.1.50146 WP_000208520.1.5017 WP_000208520.1.50179 WP_000208520.1.50182 WP_000208520.1.50187 WP_000208520.1.50191 WP_000208520.1.50228 WP_000208520.1.50258 WP_000208520.1.50262 WP_000208520.1.50266 WP_000208520.1.50269 WP_000208520.1.50270 WP_000208520.1.50278 WP_000208520.1.50304 WP_000208520.1.50345 WP_000208520.1.50353 WP_000208520.1.50358 WP_000208520.1.50361 WP_000208520.1.50366 WP_000208520.1.5037 WP_000208520.1.50380 WP_000208520.1.50412 WP_000208520.1.50418 WP_000208520.1.50427 WP_000208520.1.50452 WP_000208520.1.50549 WP_000208520.1.5056 WP_000208520.1.50564 WP_000208520.1.50579 WP_000208520.1.50585 WP_000208520.1.50586 WP_000208520.1.50608 WP_000208520.1.50616 WP_000208520.1.5064 WP_000208520.1.5067 WP_000208520.1.50690 WP_000208520.1.50700 WP_000208520.1.50715 WP_000208520.1.50717 WP_000208520.1.50725 WP_000208520.1.50728 WP_000208520.1.50762 WP_000208520.1.50939 WP_000208520.1.50947 WP_000208520.1.50957 WP_000208520.1.50969 WP_000208520.1.50986 WP_000208520.1.50988 WP_000208520.1.50990 WP_000208520.1.50996 WP_000208520.1.51013 WP_000208520.1.51027 WP_000208520.1.51042 WP_000208520.1.51058 WP_000208520.1.511 WP_000208520.1.51109 WP_000208520.1.51154 WP_000208520.1.51170 WP_000208520.1.51171 WP_000208520.1.51172 WP_000208520.1.51175 WP_000208520.1.51180 WP_000208520.1.51190 WP_000208520.1.51203 WP_000208520.1.51211 WP_000208520.1.5124 WP_000208520.1.51248 WP_000208520.1.51253 WP_000208520.1.51255 WP_000208520.1.51260 WP_000208520.1.51278 WP_000208520.1.5128 WP_000208520.1.51283 WP_000208520.1.51299 WP_000208520.1.51300 WP_000208520.1.51307 WP_000208520.1.51323 WP_000208520.1.51325 WP_000208520.1.51330 WP_000208520.1.51360 WP_000208520.1.51392 WP_000208520.1.51425 WP_000208520.1.51426 WP_000208520.1.51430 WP_000208520.1.51441 WP_000208520.1.5146 WP_000208520.1.51462 WP_000208520.1.51490 WP_000208520.1.51495 WP_000208520.1.51505 WP_000208520.1.51525 WP_000208520.1.5153 WP_000208520.1.51537 WP_000208520.1.51539 WP_000208520.1.51552 WP_000208520.1.5157 WP_000208520.1.5158 WP_000208520.1.51580 WP_000208520.1.51587 WP_000208520.1.51596 WP_000208520.1.51607 WP_000208520.1.51629 WP_000208520.1.51643 WP_000208520.1.51690 WP_000208520.1.51693 WP_000208520.1.51707 WP_000208520.1.51718 WP_000208520.1.5172 WP_000208520.1.51757 WP_000208520.1.51760 WP_000208520.1.51784 WP_000208520.1.51834 WP_000208520.1.51837 WP_000208520.1.51873 WP_000208520.1.51881 WP_000208520.1.51899 WP_000208520.1.51949 WP_000208520.1.51968 WP_000208520.1.51979 WP_000208520.1.51988 WP_000208520.1.52020 WP_000208520.1.52039 WP_000208520.1.52048 WP_000208520.1.52062 WP_000208520.1.52076 WP_000208520.1.52085 WP_000208520.1.52098 WP_000208520.1.52127 WP_000208520.1.52135 WP_000208520.1.52137 WP_000208520.1.5217 WP_000208520.1.52171 WP_000208520.1.52186 WP_000208520.1.52200 WP_000208520.1.52211 WP_000208520.1.52213 WP_000208520.1.52214 WP_000208520.1.52243 WP_000208520.1.52249 WP_000208520.1.52257 WP_000208520.1.52258 WP_000208520.1.5227 WP_000208520.1.52270 WP_000208520.1.52271 WP_000208520.1.52272 WP_000208520.1.52305 WP_000208520.1.52313 WP_000208520.1.52333 WP_000208520.1.52378 WP_000208520.1.5239 WP_000208520.1.52399 WP_000208520.1.52492 WP_000208520.1.52496 WP_000208520.1.52524 WP_000208520.1.52542 WP_000208520.1.52543 WP_000208520.1.52544 WP_000208520.1.52558 WP_000208520.1.52568 WP_000208520.1.52631 WP_000208520.1.5265 WP_000208520.1.52691 WP_000208520.1.52704 WP_000208520.1.5272 WP_000208520.1.52735 WP_000208520.1.52762 WP_000208520.1.52771 WP_000208520.1.52774 WP_000208520.1.52777 WP_000208520.1.52781 WP_000208520.1.52801 WP_000208520.1.52804 WP_000208520.1.52844 WP_000208520.1.52846 WP_000208520.1.5285 WP_000208520.1.52852 WP_000208520.1.52855 WP_000208520.1.52881 WP_000208520.1.52883 WP_000208520.1.52895 WP_000208520.1.52933 WP_000208520.1.52945 WP_000208520.1.52962 WP_000208520.1.52995 WP_000208520.1.53012 WP_000208520.1.53020 WP_000208520.1.53021 WP_000208520.1.53084 WP_000208520.1.53095 WP_000208520.1.5310 WP_000208520.1.53110 WP_000208520.1.53123 WP_000208520.1.53155 WP_000208520.1.53162 WP_000208520.1.53181 WP_000208520.1.532 WP_000208520.1.53211 WP_000208520.1.5322 WP_000208520.1.53223 WP_000208520.1.53238 WP_000208520.1.53244 WP_000208520.1.53251 WP_000208520.1.53262 WP_000208520.1.53270 WP_000208520.1.53327 WP_000208520.1.53360 WP_000208520.1.53377 WP_000208520.1.53401 WP_000208520.1.53415 WP_000208520.1.5342 WP_000208520.1.53428 WP_000208520.1.53482 WP_000208520.1.53505 WP_000208520.1.53537 WP_000208520.1.53545 WP_000208520.1.53556 WP_000208520.1.53557 WP_000208520.1.53589 WP_000208520.1.53590 WP_000208520.1.53592 WP_000208520.1.53594 WP_000208520.1.53645 WP_000208520.1.53649 WP_000208520.1.53687 WP_000208520.1.53690 WP_000208520.1.53693 WP_000208520.1.53706 WP_000208520.1.53809 WP_000208520.1.53841 WP_000208520.1.53866 WP_000208520.1.53884 WP_000208520.1.5391 WP_000208520.1.53931 WP_000208520.1.53940 WP_000208520.1.53966 WP_000208520.1.53972 WP_000208520.1.53978 WP_000208520.1.53991 WP_000208520.1.53994 WP_000208520.1.54002 WP_000208520.1.54013 WP_000208520.1.54023 WP_000208520.1.54024 WP_000208520.1.54028 WP_000208520.1.54091 WP_000208520.1.54095 WP_000208520.1.54104 WP_000208520.1.54144 WP_000208520.1.54169 WP_000208520.1.54185 WP_000208520.1.54202 WP_000208520.1.54208 WP_000208520.1.54213 WP_000208520.1.54307 WP_000208520.1.54313 WP_000208520.1.54317 WP_000208520.1.54328 WP_000208520.1.54329 WP_000208520.1.5434 WP_000208520.1.54344 WP_000208520.1.54359 WP_000208520.1.5441 WP_000208520.1.54411 WP_000208520.1.54417 WP_000208520.1.54418 WP_000208520.1.54429 WP_000208520.1.54439 WP_000208520.1.54454 WP_000208520.1.54463 WP_000208520.1.54507 WP_000208520.1.54524 WP_000208520.1.54534 WP_000208520.1.54546 WP_000208520.1.54585 WP_000208520.1.54590 WP_000208520.1.54591 WP_000208520.1.5460 WP_000208520.1.54601 WP_000208520.1.54602 WP_000208520.1.54605 WP_000208520.1.5461 WP_000208520.1.54617 WP_000208520.1.54620 WP_000208520.1.54625 WP_000208520.1.54643 WP_000208520.1.5467 WP_000208520.1.54695 WP_000208520.1.5470 WP_000208520.1.54754 WP_000208520.1.54760 WP_000208520.1.5478 WP_000208520.1.5479 WP_000208520.1.54798 WP_000208520.1.54817 WP_000208520.1.54829 WP_000208520.1.5486 WP_000208520.1.54883 WP_000208520.1.54918 WP_000208520.1.54927 WP_000208520.1.54940 WP_000208520.1.54941 WP_000208520.1.54972 WP_000208520.1.54981 WP_000208520.1.54991 WP_000208520.1.54993 WP_000208520.1.55003 WP_000208520.1.55005 WP_000208520.1.55009 WP_000208520.1.55041 WP_000208520.1.55112 WP_000208520.1.55115 WP_000208520.1.5512 WP_000208520.1.55123 WP_000208520.1.55134 WP_000208520.1.55149 WP_000208520.1.55151 WP_000208520.1.55185 WP_000208520.1.55197 WP_000208520.1.5520 WP_000208520.1.55203 WP_000208520.1.55218 WP_000208520.1.55222 WP_000208520.1.55226 WP_000208520.1.55275 WP_000208520.1.55286 WP_000208520.1.55291 WP_000208520.1.55338 WP_000208520.1.55342 WP_000208520.1.55357 WP_000208520.1.55359 WP_000208520.1.55374 WP_000208520.1.55381 WP_000208520.1.55417 WP_000208520.1.55424 WP_000208520.1.55425 WP_000208520.1.5546 WP_000208520.1.55466 WP_000208520.1.55472 WP_000208520.1.55489 WP_000208520.1.55492 WP_000208520.1.55507 WP_000208520.1.55529 WP_000208520.1.55551 WP_000208520.1.55552 WP_000208520.1.55556 WP_000208520.1.55560 WP_000208520.1.55563 WP_000208520.1.55571 WP_000208520.1.55574 WP_000208520.1.55597 WP_000208520.1.55608 WP_000208520.1.5561 WP_000208520.1.55629 WP_000208520.1.55676 WP_000208520.1.5570 WP_000208520.1.55709 WP_000208520.1.55720 WP_000208520.1.55731 WP_000208520.1.55744 WP_000208520.1.55757 WP_000208520.1.55787 WP_000208520.1.55790 WP_000208520.1.55791 WP_000208520.1.55808 WP_000208520.1.55820 WP_000208520.1.55825 WP_000208520.1.55838 WP_000208520.1.55844 WP_000208520.1.55868 WP_000208520.1.55870 WP_000208520.1.55892 WP_000208520.1.55896 WP_000208520.1.55897 WP_000208520.1.55936 WP_000208520.1.55981 WP_000208520.1.55988 WP_000208520.1.55990 WP_000208520.1.56033 WP_000208520.1.56040 WP_000208520.1.56047 WP_000208520.1.56072 WP_000208520.1.56122 WP_000208520.1.56139 WP_000208520.1.5614 WP_000208520.1.56142 WP_000208520.1.56149 WP_000208520.1.56151 WP_000208520.1.5616 WP_000208520.1.56164 WP_000208520.1.56169 WP_000208520.1.56193 WP_000208520.1.562 WP_000208520.1.56278 WP_000208520.1.56293 WP_000208520.1.56302 WP_000208520.1.5632 WP_000208520.1.56338 WP_000208520.1.56371 WP_000208520.1.5639 WP_000208520.1.56390 WP_000208520.1.56392 WP_000208520.1.56402 WP_000208520.1.56436 WP_000208520.1.56457 WP_000208520.1.5646 WP_000208520.1.56469 WP_000208520.1.56481 WP_000208520.1.56489 WP_000208520.1.56491 WP_000208520.1.56502 WP_000208520.1.56513 WP_000208520.1.56528 WP_000208520.1.56543 WP_000208520.1.56554 WP_000208520.1.56571 WP_000208520.1.56586 WP_000208520.1.56662 WP_000208520.1.56665 WP_000208520.1.56680 WP_000208520.1.56689 WP_000208520.1.5670 WP_000208520.1.56714 WP_000208520.1.56742 WP_000208520.1.56786 WP_000208520.1.56789 WP_000208520.1.56799 WP_000208520.1.56821 WP_000208520.1.56830 WP_000208520.1.56835 WP_000208520.1.56846 WP_000208520.1.5685 WP_000208520.1.56871 WP_000208520.1.56882 WP_000208520.1.56932 WP_000208520.1.56933 WP_000208520.1.56934 WP_000208520.1.56936 WP_000208520.1.56941 WP_000208520.1.56978 WP_000208520.1.56980 WP_000208520.1.57011 WP_000208520.1.57032 WP_000208520.1.57045 WP_000208520.1.57051 WP_000208520.1.57068 WP_000208520.1.57071 WP_000208520.1.57072 WP_000208520.1.57079 WP_000208520.1.57086 WP_000208520.1.57100 WP_000208520.1.57124 WP_000208520.1.57159 WP_000208520.1.57180 WP_000208520.1.57181 WP_000208520.1.57182 WP_000208520.1.57185 WP_000208520.1.57197 WP_000208520.1.57202 WP_000208520.1.57213 WP_000208520.1.57222 WP_000208520.1.57266 WP_000208520.1.57278 WP_000208520.1.57280 WP_000208520.1.57281 WP_000208520.1.57349 WP_000208520.1.57386 WP_000208520.1.57401 WP_000208520.1.57403 WP_000208520.1.57410 WP_000208520.1.57414 WP_000208520.1.5742 WP_000208520.1.57432 WP_000208520.1.57438 WP_000208520.1.57451 WP_000208520.1.57453 WP_000208520.1.57466 WP_000208520.1.57487 WP_000208520.1.57492 WP_000208520.1.57517 WP_000208520.1.57538 WP_000208520.1.57539 WP_000208520.1.5755 WP_000208520.1.57550 WP_000208520.1.57558 WP_000208520.1.57608 WP_000208520.1.57610 WP_000208520.1.57638 WP_000208520.1.5764 WP_000208520.1.57646 WP_000208520.1.57659 WP_000208520.1.57669 WP_000208520.1.57719 WP_000208520.1.57738 WP_000208520.1.57812 WP_000208520.1.57832 WP_000208520.1.57836 WP_000208520.1.57846 WP_000208520.1.57851 WP_000208520.1.5786 WP_000208520.1.5787 WP_000208520.1.57904 WP_000208520.1.57982 WP_000208520.1.57983 WP_000208520.1.57994 WP_000208520.1.58022 WP_000208520.1.58038 WP_000208520.1.58045 WP_000208520.1.58048 WP_000208520.1.58057 WP_000208520.1.58060 WP_000208520.1.58080 WP_000208520.1.58092 WP_000208520.1.58094 WP_000208520.1.58097 WP_000208520.1.58098 WP_000208520.1.5810 WP_000208520.1.58128 WP_000208520.1.58143 WP_000208520.1.58146 WP_000208520.1.58163 WP_000208520.1.58169 WP_000208520.1.58172 WP_000208520.1.58226 WP_000208520.1.58232 WP_000208520.1.58233 WP_000208520.1.58238 WP_000208520.1.58244 WP_000208520.1.58248 WP_000208520.1.58267 WP_000208520.1.58316 WP_000208520.1.58336 WP_000208520.1.58340 WP_000208520.1.58345 WP_000208520.1.58371 WP_000208520.1.58384 WP_000208520.1.584 WP_000208520.1.58401 WP_000208520.1.58408 WP_000208520.1.5842 WP_000208520.1.58420 WP_000208520.1.58423 WP_000208520.1.58429 WP_000208520.1.58440 WP_000208520.1.58444 WP_000208520.1.58449 WP_000208520.1.58475 WP_000208520.1.58493 WP_000208520.1.585 WP_000208520.1.58507 WP_000208520.1.58514 WP_000208520.1.5852 WP_000208520.1.58528 WP_000208520.1.58547 WP_000208520.1.58552 WP_000208520.1.58560 WP_000208520.1.58572 WP_000208520.1.58582 WP_000208520.1.58609 WP_000208520.1.58617 WP_000208520.1.58622 WP_000208520.1.58692 WP_000208520.1.58705 WP_000208520.1.58707 WP_000208520.1.58723 WP_000208520.1.58737 WP_000208520.1.58799 WP_000208520.1.58837 WP_000208520.1.58867 WP_000208520.1.58870 WP_000208520.1.58901 WP_000208520.1.58940 WP_000208520.1.58951 WP_000208520.1.58958 WP_000208520.1.58976 WP_000208520.1.58977 WP_000208520.1.58983 WP_000208520.1.58999 WP_000208520.1.59024 WP_000208520.1.59038 WP_000208520.1.59047 WP_000208520.1.59055 WP_000208520.1.5906 WP_000208520.1.59060 WP_000208520.1.59073 WP_000208520.1.59083 WP_000208520.1.59119 WP_000208520.1.59174 WP_000208520.1.59190 WP_000208520.1.59263 WP_000208520.1.59292 WP_000208520.1.59293 WP_000208520.1.59302 WP_000208520.1.59306 WP_000208520.1.59359 WP_000208520.1.59374 WP_000208520.1.59395 WP_000208520.1.59407 WP_000208520.1.59409 WP_000208520.1.59413 WP_000208520.1.5942 WP_000208520.1.59423 WP_000208520.1.59425 WP_000208520.1.59426 WP_000208520.1.59434 WP_000208520.1.59470 WP_000208520.1.59483 WP_000208520.1.59491 WP_000208520.1.59513 WP_000208520.1.59533 WP_000208520.1.59553 WP_000208520.1.59572 WP_000208520.1.59577 WP_000208520.1.59611 WP_000208520.1.59615 WP_000208520.1.59621 WP_000208520.1.5963 WP_000208520.1.59638 WP_000208520.1.5965 WP_000208520.1.59660 WP_000208520.1.59679 WP_000208520.1.59699 WP_000208520.1.59717 WP_000208520.1.59730 WP_000208520.1.59733 WP_000208520.1.59737 WP_000208520.1.59745 WP_000208520.1.59748 WP_000208520.1.59756 WP_000208520.1.59781 WP_000208520.1.59782 WP_000208520.1.59788 WP_000208520.1.59791 WP_000208520.1.59793 WP_000208520.1.59815 WP_000208520.1.59823 WP_000208520.1.59836 WP_000208520.1.59838 WP_000208520.1.59853 WP_000208520.1.59858 WP_000208520.1.59877 WP_000208520.1.59900 WP_000208520.1.59905 WP_000208520.1.59931 WP_000208520.1.59932 WP_000208520.1.59959 WP_000208520.1.59970 WP_000208520.1.59980 WP_000208520.1.59998 WP_000208520.1.6002 WP_000208520.1.60023 WP_000208520.1.60031 WP_000208520.1.60043 WP_000208520.1.60070 WP_000208520.1.60096 WP_000208520.1.60110 WP_000208520.1.60117 WP_000208520.1.6013 WP_000208520.1.60133 WP_000208520.1.60151 WP_000208520.1.6022 WP_000208520.1.60225 WP_000208520.1.60228 WP_000208520.1.60235 WP_000208520.1.60304 WP_000208520.1.60325 WP_000208520.1.60337 WP_000208520.1.60343 WP_000208520.1.60373 WP_000208520.1.60374 WP_000208520.1.60387 WP_000208520.1.60411 WP_000208520.1.60453 WP_000208520.1.60457 WP_000208520.1.60461 WP_000208520.1.60477 WP_000208520.1.60491 WP_000208520.1.60498 WP_000208520.1.60505 WP_000208520.1.60544 WP_000208520.1.60550 WP_000208520.1.60555 WP_000208520.1.60567 WP_000208520.1.60576 WP_000208520.1.6059 WP_000208520.1.60606 WP_000208520.1.60613 WP_000208520.1.6064 WP_000208520.1.60647 WP_000208520.1.60654 WP_000208520.1.6066 WP_000208520.1.6068 WP_000208520.1.60717 WP_000208520.1.60732 WP_000208520.1.60744 WP_000208520.1.60761 WP_000208520.1.60764 WP_000208520.1.60805 WP_000208520.1.60832 WP_000208520.1.60835 WP_000208520.1.60872 WP_000208520.1.60895 WP_000208520.1.60901 WP_000208520.1.60927 WP_000208520.1.60935 WP_000208520.1.61005 WP_000208520.1.61006 WP_000208520.1.61008 WP_000208520.1.61035 WP_000208520.1.61039 WP_000208520.1.61046 WP_000208520.1.61058 WP_000208520.1.6106 WP_000208520.1.61096 WP_000208520.1.61097 WP_000208520.1.61099 WP_000208520.1.6110 WP_000208520.1.61102 WP_000208520.1.61108 WP_000208520.1.61112 WP_000208520.1.61121 WP_000208520.1.61132 WP_000208520.1.61170 WP_000208520.1.61174 WP_000208520.1.61175 WP_000208520.1.61181 WP_000208520.1.61183 WP_000208520.1.61186 WP_000208520.1.61225 WP_000208520.1.61241 WP_000208520.1.61245 WP_000208520.1.61253 WP_000208520.1.61284 WP_000208520.1.61360 WP_000208520.1.61364 WP_000208520.1.61398 WP_000208520.1.61445 WP_000208520.1.61480 WP_000208520.1.615 WP_000208520.1.61512 WP_000208520.1.61551 WP_000208520.1.61608 WP_000208520.1.61617 WP_000208520.1.61623 WP_000208520.1.61636 WP_000208520.1.61663 WP_000208520.1.61758 WP_000208520.1.61770 WP_000208520.1.61772 WP_000208520.1.61779 WP_000208520.1.61789 WP_000208520.1.618 WP_000208520.1.61806 WP_000208520.1.61822 WP_000208520.1.61858 WP_000208520.1.61874 WP_000208520.1.61926 WP_000208520.1.61939 WP_000208520.1.61948 WP_000208520.1.61949 WP_000208520.1.61955 WP_000208520.1.61957 WP_000208520.1.61985 WP_000208520.1.62041 WP_000208520.1.62091 WP_000208520.1.62099 WP_000208520.1.62102 WP_000208520.1.6212 WP_000208520.1.62135 WP_000208520.1.62157 WP_000208520.1.62182 WP_000208520.1.62207 WP_000208520.1.62262 WP_000208520.1.62264 WP_000208520.1.62266 WP_000208520.1.62273 WP_000208520.1.62282 WP_000208520.1.62290 WP_000208520.1.62296 WP_000208520.1.62322 WP_000208520.1.62337 WP_000208520.1.62358 WP_000208520.1.62424 WP_000208520.1.62447 WP_000208520.1.62454 WP_000208520.1.62460 WP_000208520.1.62480 WP_000208520.1.62481 WP_000208520.1.62503 WP_000208520.1.62514 WP_000208520.1.62529 WP_000208520.1.62541 WP_000208520.1.62555 WP_000208520.1.62586 WP_000208520.1.6261 WP_000208520.1.62612 WP_000208520.1.62631 WP_000208520.1.62642 WP_000208520.1.62646 WP_000208520.1.62668 WP_000208520.1.62675 WP_000208520.1.62681 WP_000208520.1.62714 WP_000208520.1.62735 WP_000208520.1.62750 WP_000208520.1.62762 WP_000208520.1.62784 WP_000208520.1.62788 WP_000208520.1.62812 WP_000208520.1.62818 WP_000208520.1.62840 WP_000208520.1.62843 WP_000208520.1.62850 WP_000208520.1.62851 WP_000208520.1.62888 WP_000208520.1.62914 WP_000208520.1.62919 WP_000208520.1.6293 WP_000208520.1.62931 WP_000208520.1.62959 WP_000208520.1.62989 WP_000208520.1.6299 WP_000208520.1.6307 WP_000208520.1.63078 WP_000208520.1.63113 WP_000208520.1.63167 WP_000208520.1.63177 WP_000208520.1.63189 WP_000208520.1.6323 WP_000208520.1.63246 WP_000208520.1.63271 WP_000208520.1.63285 WP_000208520.1.63287 WP_000208520.1.63305 WP_000208520.1.6331 WP_000208520.1.63310 WP_000208520.1.63330 WP_000208520.1.6337 WP_000208520.1.63370 WP_000208520.1.63374 WP_000208520.1.63393 WP_000208520.1.63419 WP_000208520.1.63433 WP_000208520.1.63437 WP_000208520.1.63445 WP_000208520.1.63453 WP_000208520.1.63465 WP_000208520.1.63466 WP_000208520.1.63467 WP_000208520.1.63478 WP_000208520.1.6348 WP_000208520.1.63487 WP_000208520.1.63491 WP_000208520.1.63496 WP_000208520.1.63556 WP_000208520.1.63563 WP_000208520.1.63576 WP_000208520.1.63586 WP_000208520.1.63604 WP_000208520.1.63608 WP_000208520.1.63615 WP_000208520.1.6364 WP_000208520.1.63666 WP_000208520.1.63679 WP_000208520.1.63703 WP_000208520.1.63721 WP_000208520.1.63746 WP_000208520.1.63810 WP_000208520.1.63821 WP_000208520.1.63856 WP_000208520.1.63872 WP_000208520.1.63944 WP_000208520.1.63957 WP_000208520.1.63964 WP_000208520.1.63969 WP_000208520.1.64008 WP_000208520.1.64014 WP_000208520.1.64030 WP_000208520.1.64040 WP_000208520.1.64045 WP_000208520.1.64050 WP_000208520.1.64053 WP_000208520.1.64074 WP_000208520.1.64080 WP_000208520.1.64086 WP_000208520.1.64110 WP_000208520.1.64138 WP_000208520.1.6416 WP_000208520.1.64161 WP_000208520.1.64165 WP_000208520.1.64175 WP_000208520.1.64180 WP_000208520.1.64190 WP_000208520.1.64193 WP_000208520.1.64285 WP_000208520.1.64286 WP_000208520.1.643 WP_000208520.1.6431 WP_000208520.1.64321 WP_000208520.1.64330 WP_000208520.1.64337 WP_000208520.1.64353 WP_000208520.1.64355 WP_000208520.1.64356 WP_000208520.1.64371 WP_000208520.1.64380 WP_000208520.1.64391 WP_000208520.1.6441 WP_000208520.1.64417 WP_000208520.1.64438 WP_000208520.1.64448 WP_000208520.1.6445 WP_000208520.1.64458 WP_000208520.1.6446 WP_000208520.1.64519 WP_000208520.1.64520 WP_000208520.1.64528 WP_000208520.1.64547 WP_000208520.1.64621 WP_000208520.1.64657 WP_000208520.1.64670 WP_000208520.1.64693 WP_000208520.1.64695 WP_000208520.1.647 WP_000208520.1.64707 WP_000208520.1.64746 WP_000208520.1.64749 WP_000208520.1.64784 WP_000208520.1.64789 WP_000208520.1.64840 WP_000208520.1.64881 WP_000208520.1.64901 WP_000208520.1.64912 WP_000208520.1.64926 WP_000208520.1.64946 WP_000208520.1.64970 WP_000208520.1.6499 WP_000208520.1.64990 WP_000208520.1.6500 WP_000208520.1.65023 WP_000208520.1.65035 WP_000208520.1.65040 WP_000208520.1.65056 WP_000208520.1.65061 WP_000208520.1.65084 WP_000208520.1.65097 WP_000208520.1.651 WP_000208520.1.65104 WP_000208520.1.6511 WP_000208520.1.65114 WP_000208520.1.65116 WP_000208520.1.65118 WP_000208520.1.65122 WP_000208520.1.65151 WP_000208520.1.65155 WP_000208520.1.65179 WP_000208520.1.65194 WP_000208520.1.65206 WP_000208520.1.65256 WP_000208520.1.6527 WP_000208520.1.65271 WP_000208520.1.65286 WP_000208520.1.65306 WP_000208520.1.65353 WP_000208520.1.65364 WP_000208520.1.65366 WP_000208520.1.6537 WP_000208520.1.65370 WP_000208520.1.65372 WP_000208520.1.654 WP_000208520.1.65408 WP_000208520.1.65413 WP_000208520.1.65415 WP_000208520.1.65456 WP_000208520.1.65493 WP_000208520.1.65531 WP_000208520.1.65546 WP_000208520.1.65571 WP_000208520.1.65606 WP_000208520.1.6563 WP_000208520.1.65672 WP_000208520.1.65749 WP_000208520.1.65762 WP_000208520.1.6587 WP_000208520.1.65875 WP_000208520.1.65898 WP_000208520.1.65912 WP_000208520.1.65957 WP_000208520.1.65961 WP_000208520.1.65962 WP_000208520.1.65963 WP_000208520.1.65976 WP_000208520.1.65978 WP_000208520.1.65988 WP_000208520.1.6599 WP_000208520.1.66001 WP_000208520.1.66016 WP_000208520.1.66017 WP_000208520.1.66022 WP_000208520.1.66033 WP_000208520.1.6604 WP_000208520.1.66044 WP_000208520.1.66050 WP_000208520.1.6609 WP_000208520.1.66094 WP_000208520.1.66100 WP_000208520.1.66104 WP_000208520.1.66105 WP_000208520.1.66121 WP_000208520.1.66161 WP_000208520.1.6618 WP_000208520.1.66181 WP_000208520.1.66187 WP_000208520.1.66197 WP_000208520.1.66251 WP_000208520.1.66288 WP_000208520.1.66290 WP_000208520.1.66295 WP_000208520.1.66327 WP_000208520.1.6635 WP_000208520.1.66376 WP_000208520.1.66387 WP_000208520.1.66389 WP_000208520.1.66395 WP_000208520.1.66421 WP_000208520.1.66448 WP_000208520.1.66501 WP_000208520.1.66511 WP_000208520.1.66531 WP_000208520.1.6654 WP_000208520.1.66550 WP_000208520.1.66559 WP_000208520.1.66566 WP_000208520.1.66579 WP_000208520.1.66624 WP_000208520.1.66644 WP_000208520.1.6665 WP_000208520.1.6666 WP_000208520.1.66667 WP_000208520.1.66700 WP_000208520.1.66706 WP_000208520.1.66719 WP_000208520.1.66727 WP_000208520.1.66751 WP_000208520.1.66758 WP_000208520.1.6676 WP_000208520.1.66783 WP_000208520.1.66794 WP_000208520.1.66795 WP_000208520.1.66796 WP_000208520.1.66849 WP_000208520.1.66873 WP_000208520.1.66922 WP_000208520.1.66926 WP_000208520.1.66933 WP_000208520.1.66948 WP_000208520.1.6698 WP_000208520.1.67018 WP_000208520.1.67021 WP_000208520.1.67022 WP_000208520.1.67026 WP_000208520.1.67029 WP_000208520.1.67035 WP_000208520.1.67047 WP_000208520.1.6706 WP_000208520.1.67073 WP_000208520.1.67102 WP_000208520.1.67116 WP_000208520.1.67120 WP_000208520.1.67136 WP_000208520.1.67137 WP_000208520.1.67150 WP_000208520.1.67153 WP_000208520.1.67158 WP_000208520.1.67164 WP_000208520.1.67174 WP_000208520.1.67194 WP_000208520.1.67209 WP_000208520.1.67210 WP_000208520.1.67214 WP_000208520.1.6723 WP_000208520.1.67258 WP_000208520.1.67272 WP_000208520.1.67278 WP_000208520.1.67293 WP_000208520.1.6735 WP_000208520.1.67383 WP_000208520.1.67415 WP_000208520.1.67427 WP_000208520.1.67446 WP_000208520.1.67451 WP_000208520.1.67452 WP_000208520.1.67454 WP_000208520.1.67456 WP_000208520.1.67464 WP_000208520.1.67468 WP_000208520.1.67522 WP_000208520.1.67533 WP_000208520.1.67538 WP_000208520.1.67549 WP_000208520.1.67553 WP_000208520.1.67581 WP_000208520.1.67590 WP_000208520.1.67606 WP_000208520.1.67660 WP_000208520.1.67663 WP_000208520.1.67669 WP_000208520.1.67676 WP_000208520.1.67681 WP_000208520.1.67685 WP_000208520.1.6769 WP_000208520.1.67690 WP_000208520.1.67701 WP_000208520.1.67724 WP_000208520.1.67726 WP_000208520.1.67732 WP_000208520.1.67737 WP_000208520.1.67753 WP_000208520.1.67758 WP_000208520.1.67760 WP_000208520.1.67775 WP_000208520.1.67780 WP_000208520.1.67786 WP_000208520.1.67787 WP_000208520.1.67788 WP_000208520.1.678 WP_000208520.1.67810 WP_000208520.1.67841 WP_000208520.1.67853 WP_000208520.1.67861 WP_000208520.1.6793 WP_000208520.1.67971 WP_000208520.1.67975 WP_000208520.1.67990 WP_000208520.1.67992 WP_000208520.1.67999 WP_000208520.1.68008 WP_000208520.1.68011 WP_000208520.1.68012 WP_000208520.1.6802 WP_000208520.1.68025 WP_000208520.1.6803 WP_000208520.1.68052 WP_000208520.1.68059 WP_000208520.1.68063 WP_000208520.1.68067 WP_000208520.1.68070 WP_000208520.1.68071 WP_000208520.1.68079 WP_000208520.1.68096 WP_000208520.1.6810 WP_000208520.1.68138 WP_000208520.1.6814 WP_000208520.1.68157 WP_000208520.1.68170 WP_000208520.1.68175 WP_000208520.1.68177 WP_000208520.1.682 WP_000208520.1.68200 WP_000208520.1.68271 WP_000208520.1.68279 WP_000208520.1.68283 WP_000208520.1.68292 WP_000208520.1.68300 WP_000208520.1.68336 WP_000208520.1.68341 WP_000208520.1.68347 WP_000208520.1.68362 WP_000208520.1.68372 WP_000208520.1.68395 WP_000208520.1.68396 WP_000208520.1.68411 WP_000208520.1.68441 WP_000208520.1.68442 WP_000208520.1.68493 WP_000208520.1.68523 WP_000208520.1.68524 WP_000208520.1.68534 WP_000208520.1.68566 WP_000208520.1.68572 WP_000208520.1.6860 WP_000208520.1.68609 WP_000208520.1.68632 WP_000208520.1.68695 WP_000208520.1.68697 WP_000208520.1.68701 WP_000208520.1.68711 WP_000208520.1.68731 WP_000208520.1.68750 WP_000208520.1.68751 WP_000208520.1.6877 WP_000208520.1.68795 WP_000208520.1.68797 WP_000208520.1.6880 WP_000208520.1.68801 WP_000208520.1.68847 WP_000208520.1.68865 WP_000208520.1.6887 WP_000208520.1.68915 WP_000208520.1.68924 WP_000208520.1.68936 WP_000208520.1.68952 WP_000208520.1.68956 WP_000208520.1.68989 WP_000208520.1.68995 WP_000208520.1.69033 WP_000208520.1.69054 WP_000208520.1.69098 WP_000208520.1.69127 WP_000208520.1.69144 WP_000208520.1.69158 WP_000208520.1.6916 WP_000208520.1.69160 WP_000208520.1.6921 WP_000208520.1.69221 WP_000208520.1.6923 WP_000208520.1.69247 WP_000208520.1.69258 WP_000208520.1.69261 WP_000208520.1.69303 WP_000208520.1.69305 WP_000208520.1.69341 WP_000208520.1.69350 WP_000208520.1.69351 WP_000208520.1.69382 WP_000208520.1.69390 WP_000208520.1.694 WP_000208520.1.69450 WP_000208520.1.69472 WP_000208520.1.69473 WP_000208520.1.69506 WP_000208520.1.69551 WP_000208520.1.69569 WP_000208520.1.69583 WP_000208520.1.69589 WP_000208520.1.69593 WP_000208520.1.69643 WP_000208520.1.69646 WP_000208520.1.69649 WP_000208520.1.69655 WP_000208520.1.697 WP_000208520.1.69716 WP_000208520.1.69735 WP_000208520.1.69780 WP_000208520.1.69786 WP_000208520.1.69803 WP_000208520.1.69810 WP_000208520.1.69818 WP_000208520.1.69831 WP_000208520.1.69872 WP_000208520.1.69887 WP_000208520.1.69896 WP_000208520.1.6993 WP_000208520.1.69963 WP_000208520.1.69972 WP_000208520.1.7001 WP_000208520.1.70041 WP_000208520.1.70063 WP_000208520.1.701 WP_000208520.1.70123 WP_000208520.1.70125 WP_000208520.1.7013 WP_000208520.1.70149 WP_000208520.1.7015 WP_000208520.1.70200 WP_000208520.1.70213 WP_000208520.1.70230 WP_000208520.1.70337 WP_000208520.1.70357 WP_000208520.1.70407 WP_000208520.1.70477 WP_000208520.1.70492 WP_000208520.1.7050 WP_000208520.1.70517 WP_000208520.1.7052 WP_000208520.1.70539 WP_000208520.1.70576 WP_000208520.1.70578 WP_000208520.1.70592 WP_000208520.1.70597 WP_000208520.1.70619 WP_000208520.1.70628 WP_000208520.1.70686 WP_000208520.1.70694 WP_000208520.1.70705 WP_000208520.1.70713 WP_000208520.1.70723 WP_000208520.1.70748 WP_000208520.1.70767 WP_000208520.1.70787 WP_000208520.1.70794 WP_000208520.1.70801 WP_000208520.1.70803 WP_000208520.1.70880 WP_000208520.1.7090 WP_000208520.1.70900 WP_000208520.1.70952 WP_000208520.1.70967 WP_000208520.1.71003 WP_000208520.1.7102 WP_000208520.1.71024 WP_000208520.1.71042 WP_000208520.1.71099 WP_000208520.1.71109 WP_000208520.1.71113 WP_000208520.1.71134 WP_000208520.1.71139 WP_000208520.1.71144 WP_000208520.1.71147 WP_000208520.1.71149 WP_000208520.1.71159 WP_000208520.1.71183 WP_000208520.1.71192 WP_000208520.1.71199 WP_000208520.1.71205 WP_000208520.1.7121 WP_000208520.1.71221 WP_000208520.1.71225 WP_000208520.1.71226 WP_000208520.1.71229 WP_000208520.1.71269 WP_000208520.1.71272 WP_000208520.1.71275 WP_000208520.1.71285 WP_000208520.1.71287 WP_000208520.1.71294 WP_000208520.1.71311 WP_000208520.1.71312 WP_000208520.1.71315 WP_000208520.1.71323 WP_000208520.1.71327 WP_000208520.1.71339 WP_000208520.1.71354 WP_000208520.1.71397 WP_000208520.1.71403 WP_000208520.1.71405 WP_000208520.1.71409 WP_000208520.1.71421 WP_000208520.1.71423 WP_000208520.1.71448 WP_000208520.1.71480 WP_000208520.1.71522 WP_000208520.1.71533 WP_000208520.1.71537 WP_000208520.1.71540 WP_000208520.1.71563 WP_000208520.1.71603 WP_000208520.1.71690 WP_000208520.1.71695 WP_000208520.1.71732 WP_000208520.1.71757 WP_000208520.1.71767 WP_000208520.1.71783 WP_000208520.1.71830 WP_000208520.1.71837 WP_000208520.1.71840 WP_000208520.1.71855 WP_000208520.1.71856 WP_000208520.1.71874 WP_000208520.1.71912 WP_000208520.1.7192 WP_000208520.1.71938 WP_000208520.1.71939 WP_000208520.1.71940 WP_000208520.1.71944 WP_000208520.1.71967 WP_000208520.1.71975 WP_000208520.1.71987 WP_000208520.1.71993 WP_000208520.1.71995 WP_000208520.1.72013 WP_000208520.1.72016 WP_000208520.1.72021 WP_000208520.1.72028 WP_000208520.1.72033 WP_000208520.1.7205 WP_000208520.1.72053 WP_000208520.1.72066 WP_000208520.1.72090 WP_000208520.1.72098 WP_000208520.1.7210 WP_000208520.1.72117 WP_000208520.1.72153 WP_000208520.1.72157 WP_000208520.1.72161 WP_000208520.1.72162 WP_000208520.1.72180 WP_000208520.1.72184 WP_000208520.1.72186 WP_000208520.1.72208 WP_000208520.1.72212 WP_000208520.1.72237 WP_000208520.1.72240 WP_000208520.1.72248 WP_000208520.1.7225 WP_000208520.1.72261 WP_000208520.1.72270 WP_000208520.1.72279 WP_000208520.1.72298 WP_000208520.1.723 WP_000208520.1.72316 WP_000208520.1.72322 WP_000208520.1.72337 WP_000208520.1.72352 WP_000208520.1.72359 WP_000208520.1.72388 WP_000208520.1.72397 WP_000208520.1.72425 WP_000208520.1.72427 WP_000208520.1.72431 WP_000208520.1.72469 WP_000208520.1.72485 WP_000208520.1.72493 WP_000208520.1.72507 WP_000208520.1.72511 WP_000208520.1.72522 WP_000208520.1.72535 WP_000208520.1.72537 WP_000208520.1.72544 WP_000208520.1.72551 WP_000208520.1.72582 WP_000208520.1.72599 WP_000208520.1.72606 WP_000208520.1.72608 WP_000208520.1.72614 WP_000208520.1.72616 WP_000208520.1.72619 WP_000208520.1.72641 WP_000208520.1.72643 WP_000208520.1.72652 WP_000208520.1.72663 WP_000208520.1.72694 WP_000208520.1.72695 WP_000208520.1.72700 WP_000208520.1.72725 WP_000208520.1.72729 WP_000208520.1.72745 WP_000208520.1.72751 WP_000208520.1.72758 WP_000208520.1.72764 WP_000208520.1.7277 WP_000208520.1.7281 WP_000208520.1.72857 WP_000208520.1.72858 WP_000208520.1.72860 WP_000208520.1.72869 WP_000208520.1.72893 WP_000208520.1.7291 WP_000208520.1.72910 WP_000208520.1.72913 WP_000208520.1.72947 WP_000208520.1.72950 WP_000208520.1.73000 WP_000208520.1.73032 WP_000208520.1.73039 WP_000208520.1.73061 WP_000208520.1.7307 WP_000208520.1.73072 WP_000208520.1.73075 WP_000208520.1.73085 WP_000208520.1.73094 WP_000208520.1.73126 WP_000208520.1.73129 WP_000208520.1.73197 WP_000208520.1.73215 WP_000208520.1.73217 WP_000208520.1.73230 WP_000208520.1.73243 WP_000208520.1.73249 WP_000208520.1.73257 WP_000208520.1.73259 WP_000208520.1.73277 WP_000208520.1.73283 WP_000208520.1.73291 WP_000208520.1.73292 WP_000208520.1.73295 WP_000208520.1.73326 WP_000208520.1.73333 WP_000208520.1.73340 WP_000208520.1.73343 WP_000208520.1.73344 WP_000208520.1.73349 WP_000208520.1.73385 WP_000208520.1.73430 WP_000208520.1.7345 WP_000208520.1.73486 WP_000208520.1.7349 WP_000208520.1.73524 WP_000208520.1.73565 WP_000208520.1.73604 WP_000208520.1.73626 WP_000208520.1.73663 WP_000208520.1.73700 WP_000208520.1.73709 WP_000208520.1.73717 WP_000208520.1.73743 WP_000208520.1.73748 WP_000208520.1.7376 WP_000208520.1.73783 WP_000208520.1.73785 WP_000208520.1.73797 WP_000208520.1.73801 WP_000208520.1.73807 WP_000208520.1.73827 WP_000208520.1.73835 WP_000208520.1.73843 WP_000208520.1.73844 WP_000208520.1.73846 WP_000208520.1.73859 WP_000208520.1.73882 WP_000208520.1.73897 WP_000208520.1.73908 WP_000208520.1.7392 WP_000208520.1.73934 WP_000208520.1.73942 WP_000208520.1.73968 WP_000208520.1.73992 WP_000208520.1.73995 WP_000208520.1.73996 WP_000208520.1.74032 WP_000208520.1.74041 WP_000208520.1.74045 WP_000208520.1.74046 WP_000208520.1.74051 WP_000208520.1.7411 WP_000208520.1.74123 WP_000208520.1.7413 WP_000208520.1.74156 WP_000208520.1.74184 WP_000208520.1.74185 WP_000208520.1.7424 WP_000208520.1.74251 WP_000208520.1.74267 WP_000208520.1.7429 WP_000208520.1.74309 WP_000208520.1.74358 WP_000208520.1.74365 WP_000208520.1.74367 WP_000208520.1.74431 WP_000208520.1.74444 WP_000208520.1.74445 WP_000208520.1.7446 WP_000208520.1.74478 WP_000208520.1.74491 WP_000208520.1.74501 WP_000208520.1.74513 WP_000208520.1.74520 WP_000208520.1.74521 WP_000208520.1.74528 WP_000208520.1.74532 WP_000208520.1.74536 WP_000208520.1.74549 WP_000208520.1.74557 WP_000208520.1.74574 WP_000208520.1.7461 WP_000208520.1.74611 WP_000208520.1.74625 WP_000208520.1.74631 WP_000208520.1.74652 WP_000208520.1.74670 WP_000208520.1.74682 WP_000208520.1.74687 WP_000208520.1.74688 WP_000208520.1.74689 WP_000208520.1.74691 WP_000208520.1.74705 WP_000208520.1.74713 WP_000208520.1.74720 WP_000208520.1.74735 WP_000208520.1.7475 WP_000208520.1.74752 WP_000208520.1.74765 WP_000208520.1.7478 WP_000208520.1.74811 WP_000208520.1.74828 WP_000208520.1.74844 WP_000208520.1.74852 WP_000208520.1.74854 WP_000208520.1.74880 WP_000208520.1.74885 WP_000208520.1.74889 WP_000208520.1.74895 WP_000208520.1.74904 WP_000208520.1.74915 WP_000208520.1.74962 WP_000208520.1.74998 WP_000208520.1.75021 WP_000208520.1.75029 WP_000208520.1.75030 WP_000208520.1.75050 WP_000208520.1.75087 WP_000208520.1.75100 WP_000208520.1.75118 WP_000208520.1.75139 WP_000208520.1.75145 WP_000208520.1.75149 WP_000208520.1.7516 WP_000208520.1.75164 WP_000208520.1.75181 WP_000208520.1.75209 WP_000208520.1.75218 WP_000208520.1.75228 WP_000208520.1.75243 WP_000208520.1.75248 WP_000208520.1.75254 WP_000208520.1.75270 WP_000208520.1.75272 WP_000208520.1.75306 WP_000208520.1.7536 WP_000208520.1.75360 WP_000208520.1.75367 WP_000208520.1.75382 WP_000208520.1.7539 WP_000208520.1.75419 WP_000208520.1.75428 WP_000208520.1.75435 WP_000208520.1.75465 WP_000208520.1.75491 WP_000208520.1.75507 WP_000208520.1.75515 WP_000208520.1.75536 WP_000208520.1.75537 WP_000208520.1.75557 WP_000208520.1.75577 WP_000208520.1.75588 WP_000208520.1.75594 WP_000208520.1.75644 WP_000208520.1.75672 WP_000208520.1.75676 WP_000208520.1.75679 WP_000208520.1.75687 WP_000208520.1.75694 WP_000208520.1.75696 WP_000208520.1.75699 WP_000208520.1.75725 WP_000208520.1.75735 WP_000208520.1.75758 WP_000208520.1.75767 WP_000208520.1.75786 WP_000208520.1.75808 WP_000208520.1.7583 WP_000208520.1.75839 WP_000208520.1.75853 WP_000208520.1.75918 WP_000208520.1.7597 WP_000208520.1.75973 WP_000208520.1.75983 WP_000208520.1.75989 WP_000208520.1.75995 WP_000208520.1.75999 WP_000208520.1.76005 WP_000208520.1.76019 WP_000208520.1.76030 WP_000208520.1.76039 WP_000208520.1.76054 WP_000208520.1.7608 WP_000208520.1.76087 WP_000208520.1.76119 WP_000208520.1.76129 WP_000208520.1.7613 WP_000208520.1.76152 WP_000208520.1.7617 WP_000208520.1.76184 WP_000208520.1.76189 WP_000208520.1.76196 WP_000208520.1.76211 WP_000208520.1.76237 WP_000208520.1.76268 WP_000208520.1.76269 WP_000208520.1.76305 WP_000208520.1.76312 WP_000208520.1.76325 WP_000208520.1.76361 WP_000208520.1.76384 WP_000208520.1.76387 WP_000208520.1.76390 WP_000208520.1.76407 WP_000208520.1.76446 WP_000208520.1.76448 WP_000208520.1.76462 WP_000208520.1.76469 WP_000208520.1.76477 WP_000208520.1.76504 WP_000208520.1.76542 WP_000208520.1.76547 WP_000208520.1.76595 WP_000208520.1.7661 WP_000208520.1.76643 WP_000208520.1.76656 WP_000208520.1.76660 WP_000208520.1.76697 WP_000208520.1.76701 WP_000208520.1.76707 WP_000208520.1.76712 WP_000208520.1.76751 WP_000208520.1.76759 WP_000208520.1.7680 WP_000208520.1.76815 WP_000208520.1.76827 WP_000208520.1.76831 WP_000208520.1.76863 WP_000208520.1.76909 WP_000208520.1.76918 WP_000208520.1.76933 WP_000208520.1.76961 WP_000208520.1.76965 WP_000208520.1.76966 WP_000208520.1.76994 WP_000208520.1.77015 WP_000208520.1.77022 WP_000208520.1.77036 WP_000208520.1.77042 WP_000208520.1.77070 WP_000208520.1.77099 WP_000208520.1.771 WP_000208520.1.77109 WP_000208520.1.77128 WP_000208520.1.77134 WP_000208520.1.77147 WP_000208520.1.77162 WP_000208520.1.77163 WP_000208520.1.77173 WP_000208520.1.77175 WP_000208520.1.77200 WP_000208520.1.77204 WP_000208520.1.77214 WP_000208520.1.77224 WP_000208520.1.77239 WP_000208520.1.77253 WP_000208520.1.77255 WP_000208520.1.77258 WP_000208520.1.77275 WP_000208520.1.7728 WP_000208520.1.77284 WP_000208520.1.7729 WP_000208520.1.77290 WP_000208520.1.77291 WP_000208520.1.77296 WP_000208520.1.7731 WP_000208520.1.77320 WP_000208520.1.77326 WP_000208520.1.77341 WP_000208520.1.77358 WP_000208520.1.77392 WP_000208520.1.77419 WP_000208520.1.77432 WP_000208520.1.77452 WP_000208520.1.77455 WP_000208520.1.77462 WP_000208520.1.77470 WP_000208520.1.77471 WP_000208520.1.77477 WP_000208520.1.77481 WP_000208520.1.77487 WP_000208520.1.7750 WP_000208520.1.77503 WP_000208520.1.7756 WP_000208520.1.77577 WP_000208520.1.77595 WP_000208520.1.77608 WP_000208520.1.77626 WP_000208520.1.77632 WP_000208520.1.77636 WP_000208520.1.77643 WP_000208520.1.77644 WP_000208520.1.77648 WP_000208520.1.77657 WP_000208520.1.77707 WP_000208520.1.7775 WP_000208520.1.77760 WP_000208520.1.77768 WP_000208520.1.7780 WP_000208520.1.7781 WP_000208520.1.77816 WP_000208520.1.77826 WP_000208520.1.77833 WP_000208520.1.77876 WP_000208520.1.77929 WP_000208520.1.77949 WP_000208520.1.77950 WP_000208520.1.77961 WP_000208520.1.77979 WP_000208520.1.7799 WP_000208520.1.77999 WP_000208520.1.78000 WP_000208520.1.78007 WP_000208520.1.78010 WP_000208520.1.7804 WP_000208520.1.78063 WP_000208520.1.7808 WP_000208520.1.78089 WP_000208520.1.78099 WP_000208520.1.78101 WP_000208520.1.78102 WP_000208520.1.78131 WP_000208520.1.78183 WP_000208520.1.78188 WP_000208520.1.78196 WP_000208520.1.78202 WP_000208520.1.78232 WP_000208520.1.78233 WP_000208520.1.78235 WP_000208520.1.78305 WP_000208520.1.78321 WP_000208520.1.78323 WP_000208520.1.78337 WP_000208520.1.78368 WP_000208520.1.78376 WP_000208520.1.784 WP_000208520.1.78413 WP_000208520.1.78445 WP_000208520.1.78453 WP_000208520.1.78462 WP_000208520.1.7847 WP_000208520.1.78477 WP_000208520.1.78481 WP_000208520.1.78491 WP_000208520.1.78512 WP_000208520.1.78515 WP_000208520.1.78527 WP_000208520.1.7855 WP_000208520.1.78572 WP_000208520.1.78575 WP_000208520.1.78581 WP_000208520.1.78583 WP_000208520.1.78586 WP_000208520.1.78593 WP_000208520.1.78610 WP_000208520.1.78611 WP_000208520.1.78612 WP_000208520.1.78622 WP_000208520.1.78645 WP_000208520.1.78683 WP_000208520.1.78687 WP_000208520.1.78689 WP_000208520.1.78698 WP_000208520.1.78706 WP_000208520.1.78714 WP_000208520.1.78718 WP_000208520.1.78750 WP_000208520.1.78757 WP_000208520.1.78775 WP_000208520.1.78814 WP_000208520.1.7883 WP_000208520.1.78843 WP_000208520.1.78845 WP_000208520.1.78854 WP_000208520.1.78888 WP_000208520.1.78891 WP_000208520.1.78893 WP_000208520.1.78908 WP_000208520.1.78919 WP_000208520.1.78953 WP_000208520.1.78956 WP_000208520.1.7896 WP_000208520.1.78966 WP_000208520.1.7898 WP_000208520.1.78996 WP_000208520.1.79001 WP_000208520.1.79004 WP_000208520.1.7901 WP_000208520.1.79065 WP_000208520.1.79067 WP_000208520.1.79075 WP_000208520.1.79086 WP_000208520.1.79100 WP_000208520.1.79126 WP_000208520.1.79137 WP_000208520.1.79159 WP_000208520.1.79172 WP_000208520.1.79233 WP_000208520.1.79243 WP_000208520.1.79246 WP_000208520.1.79248 WP_000208520.1.79249 WP_000208520.1.79276 WP_000208520.1.79312 WP_000208520.1.79342 WP_000208520.1.79343 WP_000208520.1.79346 WP_000208520.1.79348 WP_000208520.1.79356 WP_000208520.1.79368 WP_000208520.1.79369 WP_000208520.1.7937 WP_000208520.1.79389 WP_000208520.1.7940 WP_000208520.1.79409 WP_000208520.1.79414 WP_000208520.1.79443 WP_000208520.1.79464 WP_000208520.1.79478 WP_000208520.1.79505 WP_000208520.1.79519 WP_000208520.1.7952 WP_000208520.1.79525 WP_000208520.1.79526 WP_000208520.1.79528 WP_000208520.1.79540 WP_000208520.1.79558 WP_000208520.1.79563 WP_000208520.1.79576 WP_000208520.1.79591 WP_000208520.1.79606 WP_000208520.1.79619 WP_000208520.1.79640 WP_000208520.1.7967 WP_000208520.1.79685 WP_000208520.1.79707 WP_000208520.1.79713 WP_000208520.1.79715 WP_000208520.1.79749 WP_000208520.1.79759 WP_000208520.1.79800 WP_000208520.1.79816 WP_000208520.1.79824 WP_000208520.1.79840 WP_000208520.1.7985 WP_000208520.1.79866 WP_000208520.1.7987 WP_000208520.1.79871 WP_000208520.1.79877 WP_000208520.1.79905 WP_000208520.1.79922 WP_000208520.1.7993 WP_000208520.1.79931 WP_000208520.1.79933 WP_000208520.1.79936 WP_000208520.1.79952 WP_000208520.1.79965 WP_000208520.1.79973 WP_000208520.1.79984 WP_000208520.1.79995 WP_000208520.1.80 WP_000208520.1.80016 WP_000208520.1.80026 WP_000208520.1.8004 WP_000208520.1.80050 WP_000208520.1.80060 WP_000208520.1.80063 WP_000208520.1.80071 WP_000208520.1.80096 WP_000208520.1.8011 WP_000208520.1.80112 WP_000208520.1.80136 WP_000208520.1.80141 WP_000208520.1.80168 WP_000208520.1.80179 WP_000208520.1.80183 WP_000208520.1.80255 WP_000208520.1.80309 WP_000208520.1.80310 WP_000208520.1.80320 WP_000208520.1.80330 WP_000208520.1.80343 WP_000208520.1.80392 WP_000208520.1.80402 WP_000208520.1.80428 WP_000208520.1.80440 WP_000208520.1.80484 WP_000208520.1.80517 WP_000208520.1.80519 WP_000208520.1.80524 WP_000208520.1.8057 WP_000208520.1.80577 WP_000208520.1.80578 WP_000208520.1.80606 WP_000208520.1.80612 WP_000208520.1.80626 WP_000208520.1.80660 WP_000208520.1.80662 WP_000208520.1.80666 WP_000208520.1.8068 WP_000208520.1.80709 WP_000208520.1.80718 WP_000208520.1.80724 WP_000208520.1.80737 WP_000208520.1.80753 WP_000208520.1.80754 WP_000208520.1.80756 WP_000208520.1.8076 WP_000208520.1.80768 WP_000208520.1.80804 WP_000208520.1.80805 WP_000208520.1.80862 WP_000208520.1.80884 WP_000208520.1.8090 WP_000208520.1.80935 WP_000208520.1.80945 WP_000208520.1.80946 WP_000208520.1.80948 WP_000208520.1.80983 WP_000208520.1.80985 WP_000208520.1.810 WP_000208520.1.81026 WP_000208520.1.81032 WP_000208520.1.81034 WP_000208520.1.81036 WP_000208520.1.81056 WP_000208520.1.81070 WP_000208520.1.81098 WP_000208520.1.811 WP_000208520.1.81104 WP_000208520.1.81120 WP_000208520.1.81127 WP_000208520.1.81141 WP_000208520.1.81156 WP_000208520.1.81160 WP_000208520.1.81165 WP_000208520.1.8118 WP_000208520.1.81182 WP_000208520.1.8121 WP_000208520.1.81219 WP_000208520.1.81266 WP_000208520.1.81267 WP_000208520.1.81273 WP_000208520.1.81283 WP_000208520.1.81286 WP_000208520.1.8129 WP_000208520.1.81313 WP_000208520.1.81316 WP_000208520.1.81323 WP_000208520.1.81376 WP_000208520.1.814 WP_000208520.1.81420 WP_000208520.1.81423 WP_000208520.1.81438 WP_000208520.1.81442 WP_000208520.1.81475 WP_000208520.1.81484 WP_000208520.1.81514 WP_000208520.1.81517 WP_000208520.1.81577 WP_000208520.1.81580 WP_000208520.1.81588 WP_000208520.1.81589 WP_000208520.1.81596 WP_000208520.1.81618 WP_000208520.1.81624 WP_000208520.1.81625 WP_000208520.1.81723 WP_000208520.1.81754 WP_000208520.1.81761 WP_000208520.1.81806 WP_000208520.1.81821 WP_000208520.1.8183 WP_000208520.1.81832 WP_000208520.1.81843 WP_000208520.1.81873 WP_000208520.1.81888 WP_000208520.1.81914 WP_000208520.1.81934 WP_000208520.1.81935 WP_000208520.1.81939 WP_000208520.1.81972 WP_000208520.1.81975 WP_000208520.1.82 WP_000208520.1.82010 WP_000208520.1.82057 WP_000208520.1.82059 WP_000208520.1.82062 WP_000208520.1.82074 WP_000208520.1.82104 WP_000208520.1.82106 WP_000208520.1.82123 WP_000208520.1.82137 WP_000208520.1.82217 WP_000208520.1.82221 WP_000208520.1.82239 WP_000208520.1.82240 WP_000208520.1.82242 WP_000208520.1.82246 WP_000208520.1.82275 WP_000208520.1.82296 WP_000208520.1.82316 WP_000208520.1.82326 WP_000208520.1.8235 WP_000208520.1.82439 WP_000208520.1.82485 WP_000208520.1.82499 WP_000208520.1.82514 WP_000208520.1.82527 WP_000208520.1.82536 WP_000208520.1.82539 WP_000208520.1.8255 WP_000208520.1.82572 WP_000208520.1.82594 WP_000208520.1.82626 WP_000208520.1.82629 WP_000208520.1.82647 WP_000208520.1.82661 WP_000208520.1.8268 WP_000208520.1.82691 WP_000208520.1.82698 WP_000208520.1.82700 WP_000208520.1.82711 WP_000208520.1.82715 WP_000208520.1.82718 WP_000208520.1.82747 WP_000208520.1.82754 WP_000208520.1.8277 WP_000208520.1.82776 WP_000208520.1.82784 WP_000208520.1.82797 WP_000208520.1.82799 WP_000208520.1.82808 WP_000208520.1.82816 WP_000208520.1.82820 WP_000208520.1.82831 WP_000208520.1.82833 WP_000208520.1.82853 WP_000208520.1.82901 WP_000208520.1.82923 WP_000208520.1.8295 WP_000208520.1.82991 WP_000208520.1.83020 WP_000208520.1.83035 WP_000208520.1.83036 WP_000208520.1.83059 WP_000208520.1.8306 WP_000208520.1.8308 WP_000208520.1.83099 WP_000208520.1.831 WP_000208520.1.83118 WP_000208520.1.83127 WP_000208520.1.83140 WP_000208520.1.83144 WP_000208520.1.83151 WP_000208520.1.83205 WP_000208520.1.83214 WP_000208520.1.83224 WP_000208520.1.83238 WP_000208520.1.83253 WP_000208520.1.83256 WP_000208520.1.83375 WP_000208520.1.83415 WP_000208520.1.83481 WP_000208520.1.83537 WP_000208520.1.83544 WP_000208520.1.83564 WP_000208520.1.83582 WP_000208520.1.83644 WP_000208520.1.83660 WP_000208520.1.8368 WP_000208520.1.83684 WP_000208520.1.83712 WP_000208520.1.83735 WP_000208520.1.83762 WP_000208520.1.83781 WP_000208520.1.83807 WP_000208520.1.83820 WP_000208520.1.8384 WP_000208520.1.8386 WP_000208520.1.83879 WP_000208520.1.83911 WP_000208520.1.83941 WP_000208520.1.84004 WP_000208520.1.84021 WP_000208520.1.8405 WP_000208520.1.84059 WP_000208520.1.84060 WP_000208520.1.8408 WP_000208520.1.8411 WP_000208520.1.84140 WP_000208520.1.84172 WP_000208520.1.84185 WP_000208520.1.84210 WP_000208520.1.84215 WP_000208520.1.84219 WP_000208520.1.84221 WP_000208520.1.84264 WP_000208520.1.84298 WP_000208520.1.84312 WP_000208520.1.84313 WP_000208520.1.84316 WP_000208520.1.84319 WP_000208520.1.84331 WP_000208520.1.84339 WP_000208520.1.84348 WP_000208520.1.84402 WP_000208520.1.84405 WP_000208520.1.84410 WP_000208520.1.8444 WP_000208520.1.84464 WP_000208520.1.84467 WP_000208520.1.8447 WP_000208520.1.84476 WP_000208520.1.84482 WP_000208520.1.84484 WP_000208520.1.84486 WP_000208520.1.84531 WP_000208520.1.84534 WP_000208520.1.84584 WP_000208520.1.84635 WP_000208520.1.84639 WP_000208520.1.84656 WP_000208520.1.84657 WP_000208520.1.84697 WP_000208520.1.8470 WP_000208520.1.84731 WP_000208520.1.84738 WP_000208520.1.84740 WP_000208520.1.8477 WP_000208520.1.84784 WP_000208520.1.84797 WP_000208520.1.84850 WP_000208520.1.84875 WP_000208520.1.84881 WP_000208520.1.84894 WP_000208520.1.84929 WP_000208520.1.84941 WP_000208520.1.84948 WP_000208520.1.84966 WP_000208520.1.84972 WP_000208520.1.84977 WP_000208520.1.84994 WP_000208520.1.85002 WP_000208520.1.85011 WP_000208520.1.85025 WP_000208520.1.85048 WP_000208520.1.85052 WP_000208520.1.85077 WP_000208520.1.85085 WP_000208520.1.85090 WP_000208520.1.85098 WP_000208520.1.85105 WP_000208520.1.85106 WP_000208520.1.85112 WP_000208520.1.85125 WP_000208520.1.85138 WP_000208520.1.85155 WP_000208520.1.8517 WP_000208520.1.85175 WP_000208520.1.85188 WP_000208520.1.85216 WP_000208520.1.85241 WP_000208520.1.85247 WP_000208520.1.85252 WP_000208520.1.85253 WP_000208520.1.85255 WP_000208520.1.85260 WP_000208520.1.8530 WP_000208520.1.85310 WP_000208520.1.85315 WP_000208520.1.85320 WP_000208520.1.85323 WP_000208520.1.85329 WP_000208520.1.85336 WP_000208520.1.85361 WP_000208520.1.85384 WP_000208520.1.85435 WP_000208520.1.85500 WP_000208520.1.85504 WP_000208520.1.85525 WP_000208520.1.85554 WP_000208520.1.85558 WP_000208520.1.85578 WP_000208520.1.85593 WP_000208520.1.85621 WP_000208520.1.85623 WP_000208520.1.8564 WP_000208520.1.85657 WP_000208520.1.85722 WP_000208520.1.85752 WP_000208520.1.85762 WP_000208520.1.85772 WP_000208520.1.85773 WP_000208520.1.85781 WP_000208520.1.8579 WP_000208520.1.85806 WP_000208520.1.85857 WP_000208520.1.8592 WP_000208520.1.85939 WP_000208520.1.85944 WP_000208520.1.85948 WP_000208520.1.86001 WP_000208520.1.86016 WP_000208520.1.8603 WP_000208520.1.86035 WP_000208520.1.86104 WP_000208520.1.86105 WP_000208520.1.86149 WP_000208520.1.86161 WP_000208520.1.86166 WP_000208520.1.86171 WP_000208520.1.86176 WP_000208520.1.86179 WP_000208520.1.86189 WP_000208520.1.86196 WP_000208520.1.8621 WP_000208520.1.86210 WP_000208520.1.86225 WP_000208520.1.86227 WP_000208520.1.86228 WP_000208520.1.86234 WP_000208520.1.86255 WP_000208520.1.86261 WP_000208520.1.86266 WP_000208520.1.86273 WP_000208520.1.86276 WP_000208520.1.86283 WP_000208520.1.86294 WP_000208520.1.86307 WP_000208520.1.86340 WP_000208520.1.86353 WP_000208520.1.86355 WP_000208520.1.86364 WP_000208520.1.86371 WP_000208520.1.86376 WP_000208520.1.86393 WP_000208520.1.86411 WP_000208520.1.86412 WP_000208520.1.86437 WP_000208520.1.86451 WP_000208520.1.86452 WP_000208520.1.86454 WP_000208520.1.86461 WP_000208520.1.86475 WP_000208520.1.86492 WP_000208520.1.8652 WP_000208520.1.8656 WP_000208520.1.86560 WP_000208520.1.86574 WP_000208520.1.86583 WP_000208520.1.86598 WP_000208520.1.86609 WP_000208520.1.86613 WP_000208520.1.86617 WP_000208520.1.86627 WP_000208520.1.86640 WP_000208520.1.86667 WP_000208520.1.86673 WP_000208520.1.86681 WP_000208520.1.86691 WP_000208520.1.86707 WP_000208520.1.86717 WP_000208520.1.86727 WP_000208520.1.86731 WP_000208520.1.86734 WP_000208520.1.86753 WP_000208520.1.86760 WP_000208520.1.86768 WP_000208520.1.86787 WP_000208520.1.86788 WP_000208520.1.8679 WP_000208520.1.86833 WP_000208520.1.86848 WP_000208520.1.8687 WP_000208520.1.86956 WP_000208520.1.86959 WP_000208520.1.86994 WP_000208520.1.86997 WP_000208520.1.87043 WP_000208520.1.87067 WP_000208520.1.87074 WP_000208520.1.87075 WP_000208520.1.87076 WP_000208520.1.87102 WP_000208520.1.87109 WP_000208520.1.8711 WP_000208520.1.87147 WP_000208520.1.87189 WP_000208520.1.87199 WP_000208520.1.87205 WP_000208520.1.87247 WP_000208520.1.87249 WP_000208520.1.87254 WP_000208520.1.87310 WP_000208520.1.87358 WP_000208520.1.87371 WP_000208520.1.87382 WP_000208520.1.87389 WP_000208520.1.87400 WP_000208520.1.87465 WP_000208520.1.87491 WP_000208520.1.87563 WP_000208520.1.87568 WP_000208520.1.87574 WP_000208520.1.87581 WP_000208520.1.87607 WP_000208520.1.87610 WP_000208520.1.87616 WP_000208520.1.87633 WP_000208520.1.87635 WP_000208520.1.87675 WP_000208520.1.87694 WP_000208520.1.87696 WP_000208520.1.87721 WP_000208520.1.87726 WP_000208520.1.87728 WP_000208520.1.87766 WP_000208520.1.8778 WP_000208520.1.87788 WP_000208520.1.87789 WP_000208520.1.87822 WP_000208520.1.87834 WP_000208520.1.87857 WP_000208520.1.87883 WP_000208520.1.87914 WP_000208520.1.87976 WP_000208520.1.87980 WP_000208520.1.87989 WP_000208520.1.87990 WP_000208520.1.88017 WP_000208520.1.88020 WP_000208520.1.8807 WP_000208520.1.88082 WP_000208520.1.88088 WP_000208520.1.88110 WP_000208520.1.88119 WP_000208520.1.88147 WP_000208520.1.88149 WP_000208520.1.88155 WP_000208520.1.88197 WP_000208520.1.8822 WP_000208520.1.88234 WP_000208520.1.88238 WP_000208520.1.88285 WP_000208520.1.88301 WP_000208520.1.88336 WP_000208520.1.88376 WP_000208520.1.88379 WP_000208520.1.88427 WP_000208520.1.8843 WP_000208520.1.88434 WP_000208520.1.88462 WP_000208520.1.88467 WP_000208520.1.8848 WP_000208520.1.88499 WP_000208520.1.88505 WP_000208520.1.88524 WP_000208520.1.88527 WP_000208520.1.88528 WP_000208520.1.88535 WP_000208520.1.8855 WP_000208520.1.88557 WP_000208520.1.88598 WP_000208520.1.88603 WP_000208520.1.88607 WP_000208520.1.88631 WP_000208520.1.88646 WP_000208520.1.88686 WP_000208520.1.88710 WP_000208520.1.88717 WP_000208520.1.88729 WP_000208520.1.88732 WP_000208520.1.88752 WP_000208520.1.88757 WP_000208520.1.88767 WP_000208520.1.8879 WP_000208520.1.88803 WP_000208520.1.88826 WP_000208520.1.88834 WP_000208520.1.88880 WP_000208520.1.88883 WP_000208520.1.88891 WP_000208520.1.88950 WP_000208520.1.88953 WP_000208520.1.88961 WP_000208520.1.88997 WP_000208520.1.89043 WP_000208520.1.8906 WP_000208520.1.89067 WP_000208520.1.89069 WP_000208520.1.89090 WP_000208520.1.89099 WP_000208520.1.89163 WP_000208520.1.89197 WP_000208520.1.89203 WP_000208520.1.89214 WP_000208520.1.89255 WP_000208520.1.8928 WP_000208520.1.89285 WP_000208520.1.89305 WP_000208520.1.89312 WP_000208520.1.89322 WP_000208520.1.89334 WP_000208520.1.89335 WP_000208520.1.89385 WP_000208520.1.89396 WP_000208520.1.894 WP_000208520.1.89405 WP_000208520.1.89416 WP_000208520.1.89432 WP_000208520.1.8945 WP_000208520.1.89455 WP_000208520.1.89458 WP_000208520.1.89466 WP_000208520.1.89468 WP_000208520.1.89469 WP_000208520.1.89471 WP_000208520.1.89479 WP_000208520.1.89492 WP_000208520.1.89551 WP_000208520.1.89569 WP_000208520.1.89583 WP_000208520.1.89601 WP_000208520.1.89627 WP_000208520.1.89631 WP_000208520.1.89674 WP_000208520.1.89679 WP_000208520.1.89700 WP_000208520.1.89710 WP_000208520.1.89768 WP_000208520.1.89781 WP_000208520.1.89788 WP_000208520.1.89818 WP_000208520.1.89839 WP_000208520.1.89852 WP_000208520.1.89859 WP_000208520.1.89879 WP_000208520.1.89915 WP_000208520.1.89917 WP_000208520.1.89918 WP_000208520.1.89920 WP_000208520.1.89923 WP_000208520.1.89927 WP_000208520.1.89959 WP_000208520.1.89988 WP_000208520.1.90017 WP_000208520.1.90022 WP_000208520.1.90050 WP_000208520.1.90063 WP_000208520.1.90078 WP_000208520.1.9009 WP_000208520.1.9010 WP_000208520.1.90128 WP_000208520.1.90139 WP_000208520.1.90146 WP_000208520.1.90168 WP_000208520.1.90171 WP_000208520.1.902 WP_000208520.1.90205 WP_000208520.1.90219 WP_000208520.1.90256 WP_000208520.1.90257 WP_000208520.1.90266 WP_000208520.1.90270 WP_000208520.1.90332 WP_000208520.1.90342 WP_000208520.1.90346 WP_000208520.1.90357 WP_000208520.1.90358 WP_000208520.1.9036 WP_000208520.1.90389 WP_000208520.1.90441 WP_000208520.1.90449 WP_000208520.1.90467 WP_000208520.1.90511 WP_000208520.1.90520 WP_000208520.1.90525 WP_000208520.1.90536 WP_000208520.1.90542 WP_000208520.1.90547 WP_000208520.1.9059 WP_000208520.1.90591 WP_000208520.1.9061 WP_000208520.1.90626 WP_000208520.1.90690 WP_000208520.1.90703 WP_000208520.1.90706 WP_000208520.1.90775 WP_000208520.1.90799 WP_000208520.1.9081 WP_000208520.1.90813 WP_000208520.1.90822 WP_000208520.1.90828 WP_000208520.1.90834 WP_000208520.1.90837 WP_000208520.1.90839 WP_000208520.1.90842 WP_000208520.1.90844 WP_000208520.1.90848 WP_000208520.1.90856 WP_000208520.1.90864 WP_000208520.1.90865 WP_000208520.1.9087 WP_000208520.1.90873 WP_000208520.1.90890 WP_000208520.1.909 WP_000208520.1.90905 WP_000208520.1.90924 WP_000208520.1.90951 WP_000208520.1.90960 WP_000208520.1.90967 WP_000208520.1.90979 WP_000208520.1.9098 WP_000208520.1.90988 WP_000208520.1.90996 WP_000208520.1.90997 WP_000208520.1.91 WP_000208520.1.91007 WP_000208520.1.91010 WP_000208520.1.91018 WP_000208520.1.9104 WP_000208520.1.91072 WP_000208520.1.91088 WP_000208520.1.91113 WP_000208520.1.91121 WP_000208520.1.91143 WP_000208520.1.91153 WP_000208520.1.91170 WP_000208520.1.91182 WP_000208520.1.91213 WP_000208520.1.91266 WP_000208520.1.91268 WP_000208520.1.91277 WP_000208520.1.91288 WP_000208520.1.91290 WP_000208520.1.91340 WP_000208520.1.91341 WP_000208520.1.91354 WP_000208520.1.91356 WP_000208520.1.91361 WP_000208520.1.91384 WP_000208520.1.91397 WP_000208520.1.91414 WP_000208520.1.91425 WP_000208520.1.91445 WP_000208520.1.91462 WP_000208520.1.91485 WP_000208520.1.915 WP_000208520.1.91511 WP_000208520.1.91516 WP_000208520.1.91543 WP_000208520.1.91548 WP_000208520.1.91549 WP_000208520.1.91551 WP_000208520.1.91565 WP_000208520.1.91566 WP_000208520.1.9157 WP_000208520.1.91596 WP_000208520.1.91626 WP_000208520.1.91640 WP_000208520.1.91643 WP_000208520.1.91651 WP_000208520.1.91672 WP_000208520.1.9168 WP_000208520.1.91685 WP_000208520.1.9169 WP_000208520.1.9171 WP_000208520.1.91739 WP_000208520.1.91756 WP_000208520.1.91777 WP_000208520.1.91782 WP_000208520.1.91787 WP_000208520.1.91801 WP_000208520.1.91843 WP_000208520.1.9185 WP_000208520.1.91850 WP_000208520.1.91863 WP_000208520.1.91871 WP_000208520.1.91879 WP_000208520.1.91954 WP_000208520.1.91959 WP_000208520.1.91965 WP_000208520.1.91971 WP_000208520.1.9199 WP_000208520.1.91994 WP_000208520.1.92005 WP_000208520.1.92014 WP_000208520.1.92025 WP_000208520.1.92031 WP_000208520.1.92048 WP_000208520.1.92058 WP_000208520.1.9209 WP_000208520.1.921 WP_000208520.1.92102 WP_000208520.1.92114 WP_000208520.1.9215 WP_000208520.1.92161 WP_000208520.1.92215 WP_000208520.1.92295 WP_000208520.1.92304 WP_000208520.1.92305 WP_000208520.1.92311 WP_000208520.1.92323 WP_000208520.1.92361 WP_000208520.1.92384 WP_000208520.1.92434 WP_000208520.1.92473 WP_000208520.1.92496 WP_000208520.1.92532 WP_000208520.1.9255 WP_000208520.1.92568 WP_000208520.1.92577 WP_000208520.1.92614 WP_000208520.1.92615 WP_000208520.1.92634 WP_000208520.1.92638 WP_000208520.1.9264 WP_000208520.1.9266 WP_000208520.1.92668 WP_000208520.1.92693 WP_000208520.1.92708 WP_000208520.1.92719 WP_000208520.1.92742 WP_000208520.1.92750 WP_000208520.1.92767 WP_000208520.1.92780 WP_000208520.1.92792 WP_000208520.1.92819 WP_000208520.1.92882 WP_000208520.1.92886 WP_000208520.1.92943 WP_000208520.1.92953 WP_000208520.1.93016 WP_000208520.1.93017 WP_000208520.1.93019 WP_000208520.1.93027 WP_000208520.1.93033 WP_000208520.1.93048 WP_000208520.1.93052 WP_000208520.1.93054 WP_000208520.1.93069 WP_000208520.1.93072 WP_000208520.1.93100 WP_000208520.1.93112 WP_000208520.1.93133 WP_000208520.1.93138 WP_000208520.1.93139 WP_000208520.1.93150 WP_000208520.1.93167 WP_000208520.1.93175 WP_000208520.1.93185 WP_000208520.1.93233 WP_000208520.1.93252 WP_000208520.1.9327 WP_000208520.1.93276 WP_000208520.1.93291 WP_000208520.1.93309 WP_000208520.1.9331 WP_000208520.1.93312 WP_000208520.1.93326 WP_000208520.1.93338 WP_000208520.1.93379 WP_000208520.1.93388 WP_000208520.1.93427 WP_000208520.1.93428 WP_000208520.1.93453 WP_000208520.1.93461 WP_000208520.1.93463 WP_000208520.1.93464 WP_000208520.1.93509 WP_000208520.1.93552 WP_000208520.1.9356 WP_000208520.1.93569 WP_000208520.1.93601 WP_000208520.1.93621 WP_000208520.1.93626 WP_000208520.1.93629 WP_000208520.1.93630 WP_000208520.1.93637 WP_000208520.1.93639 WP_000208520.1.93652 WP_000208520.1.93670 WP_000208520.1.93673 WP_000208520.1.93679 WP_000208520.1.93695 WP_000208520.1.93716 WP_000208520.1.93733 WP_000208520.1.93737 WP_000208520.1.93743 WP_000208520.1.93745 WP_000208520.1.93755 WP_000208520.1.93765 WP_000208520.1.93768 WP_000208520.1.93800 WP_000208520.1.93821 WP_000208520.1.93870 WP_000208520.1.93873 WP_000208520.1.93877 WP_000208520.1.93911 WP_000208520.1.93918 WP_000208520.1.93922 WP_000208520.1.93939 WP_000208520.1.93951 WP_000208520.1.93952 WP_000208520.1.94008 WP_000208520.1.94011 WP_000208520.1.94025 WP_000208520.1.94028 WP_000208520.1.94035 WP_000208520.1.94040 WP_000208520.1.94057 WP_000208520.1.94069 WP_000208520.1.94156 WP_000208520.1.9416 WP_000208520.1.94176 WP_000208520.1.94187 WP_000208520.1.94213 WP_000208520.1.9426 WP_000208520.1.94271 WP_000208520.1.94298 WP_000208520.1.94302 WP_000208520.1.94317 WP_000208520.1.94343 WP_000208520.1.94353 WP_000208520.1.94367 WP_000208520.1.94388 WP_000208520.1.94404 WP_000208520.1.94417 WP_000208520.1.94430 WP_000208520.1.94436 WP_000208520.1.94445 WP_000208520.1.94468 WP_000208520.1.94507 WP_000208520.1.94544 WP_000208520.1.94548 WP_000208520.1.9457 WP_000208520.1.94578 WP_000208520.1.94589 WP_000208520.1.94626 WP_000208520.1.94646 WP_000208520.1.94653 WP_000208520.1.94676 WP_000208520.1.94686 WP_000208520.1.94692 WP_000208520.1.94695 WP_000208520.1.94727 WP_000208520.1.94739 WP_000208520.1.9474 WP_000208520.1.94754 WP_000208520.1.94764 WP_000208520.1.94787 WP_000208520.1.94790 WP_000208520.1.948 WP_000208520.1.94806 WP_000208520.1.94808 WP_000208520.1.94822 WP_000208520.1.94823 WP_000208520.1.94836 WP_000208520.1.94841 WP_000208520.1.94847 WP_000208520.1.94869 WP_000208520.1.94880 WP_000208520.1.94889 WP_000208520.1.94892 WP_000208520.1.94898 WP_000208520.1.94903 WP_000208520.1.9491 WP_000208520.1.94927 WP_000208520.1.94934 WP_000208520.1.94935 WP_000208520.1.94938 WP_000208520.1.94949 WP_000208520.1.94955 WP_000208520.1.94991 WP_000208520.1.94997 WP_000208520.1.95005 WP_000208520.1.95011 WP_000208520.1.95028 WP_000208520.1.95035 WP_000208520.1.95037 WP_000208520.1.95062 WP_000208520.1.95080 WP_000208520.1.95084 WP_000208520.1.95105 WP_000208520.1.95129 WP_000208520.1.9513 WP_000208520.1.95161 WP_000208520.1.95198 WP_000208520.1.95243 WP_000208520.1.95244 WP_000208520.1.95275 WP_000208520.1.95329 WP_000208520.1.95332 WP_000208520.1.95366 WP_000208520.1.95368 WP_000208520.1.95378 WP_000208520.1.95381 WP_000208520.1.95390 WP_000208520.1.95395 WP_000208520.1.95398 WP_000208520.1.95400 WP_000208520.1.95424 WP_000208520.1.95428 WP_000208520.1.95438 WP_000208520.1.95490 WP_000208520.1.95563 WP_000208520.1.9559 WP_000208520.1.95595 WP_000208520.1.95604 WP_000208520.1.95611 WP_000208520.1.95628 WP_000208520.1.95634 WP_000208520.1.95655 WP_000208520.1.9566 WP_000208520.1.95666 WP_000208520.1.95680 WP_000208520.1.95771 WP_000208520.1.95783 WP_000208520.1.95784 WP_000208520.1.95824 WP_000208520.1.95827 WP_000208520.1.95834 WP_000208520.1.95846 WP_000208520.1.95849 WP_000208520.1.95861 WP_000208520.1.95865 WP_000208520.1.95916 WP_000208520.1.95919 WP_000208520.1.95929 WP_000208520.1.95931 WP_000208520.1.95932 WP_000208520.1.95951 WP_000208520.1.960 WP_000208520.1.96015 WP_000208520.1.96053 WP_000208520.1.96059 WP_000208520.1.96066 WP_000208520.1.96086 WP_000208520.1.96097 WP_000208520.1.96110 WP_000208520.1.96114 WP_000208520.1.96143 WP_000208520.1.96145 WP_000208520.1.9616 WP_000208520.1.96177 WP_000208520.1.96215 WP_000208520.1.96222 WP_000208520.1.96223 WP_000208520.1.96229 WP_000208520.1.96247 WP_000208520.1.96263 WP_000208520.1.96281 WP_000208520.1.96299 WP_000208520.1.96303 WP_000208520.1.96339 WP_000208520.1.96341 WP_000208520.1.96378 WP_000208520.1.96392 WP_000208520.1.96394 WP_000208520.1.9641 WP_000208520.1.96417 WP_000208520.1.96425 WP_000208520.1.96450 WP_000208520.1.96457 WP_000208520.1.96479 WP_000208520.1.96480 WP_000208520.1.96494 WP_000208520.1.965 WP_000208520.1.96519 WP_000208520.1.96541 WP_000208520.1.96558 WP_000208520.1.9657 WP_000208520.1.96585 WP_000208520.1.96609 WP_000208520.1.9661 WP_000208520.1.96617 WP_000208520.1.96650 WP_000208520.1.96659 WP_000208520.1.9668 WP_000208520.1.96695 WP_000208520.1.9671 WP_000208520.1.96725 WP_000208520.1.96743 WP_000208520.1.96759 WP_000208520.1.96762 WP_000208520.1.96796 WP_000208520.1.9682 WP_000208520.1.96820 WP_000208520.1.96864 WP_000208520.1.96894 WP_000208520.1.9690 WP_000208520.1.96907 WP_000208520.1.96924 WP_000208520.1.96944 WP_000208520.1.96971 WP_000208520.1.96984 WP_000208520.1.97011 WP_000208520.1.97027 WP_000208520.1.97049 WP_000208520.1.97059 WP_000208520.1.97119 WP_000208520.1.97123 WP_000208520.1.97147 WP_000208520.1.97160 WP_000208520.1.97170 WP_000208520.1.97193 WP_000208520.1.97200 WP_000208520.1.97226 WP_000208520.1.9723 WP_000208520.1.97231 WP_000208520.1.97238 WP_000208520.1.97247 WP_000208520.1.97248 WP_000208520.1.97269 WP_000208520.1.9729 WP_000208520.1.97292 WP_000208520.1.97344 WP_000208520.1.97351 WP_000208520.1.97360 WP_000208520.1.97361 WP_000208520.1.97379 WP_000208520.1.97387 WP_000208520.1.9740 WP_000208520.1.97402 WP_000208520.1.97421 WP_000208520.1.97434 WP_000208520.1.97437 WP_000208520.1.97439 WP_000208520.1.97459 WP_000208520.1.97464 WP_000208520.1.97490 WP_000208520.1.97502 WP_000208520.1.97513 WP_000208520.1.97538 WP_000208520.1.97544 WP_000208520.1.97549 WP_000208520.1.97560 WP_000208520.1.97571 WP_000208520.1.97619 WP_000208520.1.97632 WP_000208520.1.97667 WP_000208520.1.97677 WP_000208520.1.97685 WP_000208520.1.97705 WP_000208520.1.97789 WP_000208520.1.978 WP_000208520.1.97822 WP_000208520.1.97823 WP_000208520.1.97825 WP_000208520.1.97871 WP_000208520.1.97890 WP_000208520.1.97919 WP_000208520.1.97930 WP_000208520.1.97932 WP_000208520.1.97937 WP_000208520.1.97962 WP_000208520.1.97982 WP_000208520.1.97996 WP_000208520.1.98000 WP_000208520.1.98005 WP_000208520.1.98012 WP_000208520.1.98026 WP_000208520.1.9803 WP_000208520.1.98046 WP_000208520.1.98082 WP_000208520.1.98083 WP_000208520.1.981 WP_000208520.1.98102 WP_000208520.1.98115 WP_000208520.1.98155 WP_000208520.1.9816 WP_000208520.1.98167 WP_000208520.1.98176 WP_000208520.1.98187 WP_000208520.1.98202 WP_000208520.1.98205 WP_000208520.1.98220 WP_000208520.1.98232 WP_000208520.1.98235 WP_000208520.1.98239 WP_000208520.1.98241 WP_000208520.1.98244 WP_000208520.1.98251 WP_000208520.1.98279 WP_000208520.1.98292 WP_000208520.1.98294 WP_000208520.1.98301 WP_000208520.1.98312 WP_000208520.1.98355 WP_000208520.1.98357 WP_000208520.1.98384 WP_000208520.1.98404 WP_000208520.1.98424 WP_000208520.1.98429 WP_000208520.1.9844 WP_000208520.1.98451 WP_000208520.1.98466 WP_000208520.1.98477 WP_000208520.1.98480 WP_000208520.1.98543 WP_000208520.1.98549 WP_000208520.1.98569 WP_000208520.1.98578 WP_000208520.1.9858 WP_000208520.1.98614 WP_000208520.1.98626 WP_000208520.1.98628 WP_000208520.1.98633 WP_000208520.1.9864 WP_000208520.1.98654 WP_000208520.1.98665 WP_000208520.1.98683 WP_000208520.1.98702 WP_000208520.1.98776 WP_000208520.1.98784 WP_000208520.1.98795 WP_000208520.1.9883 WP_000208520.1.98849 WP_000208520.1.98920 WP_000208520.1.99006 WP_000208520.1.99046 WP_000208520.1.99060 WP_000208520.1.99101 WP_000208520.1.99182 WP_000208520.1.99209 WP_000208520.1.99234 WP_000208520.1.99265 WP_000208520.1.99292 WP_000208520.1.99295 WP_000208520.1.99304 WP_000208520.1.99307 WP_000208520.1.99310 WP_000208520.1.99319 WP_000208520.1.99345 WP_000208520.1.99349 WP_000208520.1.9935 WP_000208520.1.99361 WP_000208520.1.99366 WP_000208520.1.9940 WP_000208520.1.99400 WP_000208520.1.99446 WP_000208520.1.99453 WP_000208520.1.99458 WP_000208520.1.99471 WP_000208520.1.99472 WP_000208520.1.99475 WP_000208520.1.99486 WP_000208520.1.99487 WP_000208520.1.99498 WP_000208520.1.99501 WP_000208520.1.99511 WP_000208520.1.99534 WP_000208520.1.99562 WP_000208520.1.99571 WP_000208520.1.99592 WP_000208520.1.99602 WP_000208520.1.99603 WP_000208520.1.99619 WP_000208520.1.99632 WP_000208520.1.99666 WP_000208520.1.99692 WP_000208520.1.99694 WP_000208520.1.99698 WP_000208520.1.99734 WP_000208520.1.99771 WP_000208520.1.99804 WP_000208520.1.99827 WP_000208520.1.99869 WP_000208520.1.99874 WP_000208520.1.99891 WP_000208520.1.99892 WP_000208520.1.99929 WP_000208520.1.99986 YP_002408945.1.10275 YP_002414927.1.14968 YP_006122088.1.29421 YP_006781649.1.12065 YP_026247.1.90541 YP_405397.1.10455 gi|378715309|ref|YP_005280202.1| gi|387831664|ref|YP_003351601.1| gi|386616582|ref|YP_006136248.1| 155864.Z5281 199310.c4692 300267.SDY_3978 300268.SBO_3781 316385.ECDH10B_3959 316407.ilvE 331111.EcE24377A_4281 331112.EcHS_A3987 344609.SbBS512_E4150 386585.ECs4704 409438.ECSE_4053 439855.EcSMS35_4136 444450.ECH74115_5204 481805.EcolC_4232 511145.b3770 544404.ECSP_4819 573235.ECO26_4816 574521.E2348C_4072 585034.ECIAI1_3957 585054.EFER_3732 585055.EC55989_4242 585056.ECUMN_4296 585057.ECIAI39_3016 585396.ECO111_4596 595496.BWG_3455 gi|387609576|ref|YP_006098432.1| gi|170083260|ref|YP_001732580.1| gi|386641408|ref|YP_006108206.1| gi|544392201|ref|YP_008566942.1| 1i1k_A 1i1k_B 1i1k_C 1i1l_A 1i1l_B 1i1l_C 1i1m_A 1i1m_B 1i1m_C 1iyd_A 1iyd_B 1iyd_C 1iye_A 1iye_B 1iye_C gi|218707408|ref|YP_002414927.1| gi|407466776|ref|YP_006786782.1| gi|157163245|ref|YP_001460563.1| gi|157158223|ref|YP_001465251.1| gi|387623424|ref|YP_006131052.1| gi|209396780|ref|YP_002273289.1| gi|218701316|ref|YP_002408945.1| gi|386626665|ref|YP_006146393.1| gi|386711681|ref|YP_006175402.1| gi|556553621|ref|YP_008724129.1| gi|386711681|ref|YP_006175402.1| gi|386631708|ref|YP_006151428.1| gi|387619066|ref|YP_006122088.1| gi|387623424|ref|YP_006131052.1| gi|410485045|ref|YP_006772591.1| gi|386636628|ref|YP_006156347.1| gi|387885000|ref|YP_006315302.1| gi|218697488|ref|YP_002405155.1| 1iyeA gi|170680330|ref|YP_001746091.1| gi|471335269|ref|YP_007558746.1| gi|215489100|ref|YP_002331531.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]