SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1iznA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1iznA
Domain Number 1 Region: 9-274
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.68e-158
Family Capz alpha-1 subunit 0.0000000077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1iznA   PDB: 1izn   SUPERFAMILY: 1iznA
Sequence length 286
Comment (A:)
Sequence
MADFEDRVSDEEKVRIAAKFITHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNMD
QFTPVKIEGYDDQVLITEHGDLGNGRFLDPRNKISFKFDHLRKEASDPQPEDTESALKQW
RDACDSALRAYVKDHYPNGFCTVYGKSIDGQQTIIACIESHQFQPKNFWNGRWRSEWKFT
ITPPTAQVAAVLKIQVHYYEDGNVQLVSHKDIQDSVQVSSDVQTAKEFIKIIENAENEYQ
TAISENYQTMSDTTFKALRRQLPVTRTKIDWNKILSYKIGKEMQNA
Download sequence
Identical sequences P13127
1iznA ENSGALP00000002349 NP_990846.1.86415 XP_021233196.1.32913 1izn_A 1izn_C 2kz7_A 3aa0_A 3aa1_A 3aa6_A 3aa7_A 3aaa_A 3aae_A 3aae_C 3aae_E 3aae_G 3aae_I 3lk2_A 3lk3_A 3lk4_1 3lk4_4 3lk4_7 3lk4_A 3lk4_D 3lk4_G 3lk4_J 3lk4_M 3lk4_P 3lk4_S 3lk4_V 3lk4_Y

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]