SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1j1tA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1j1tA
Domain Number 1 Region: 6-233
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.11e-135
Family Alginate lyase 0.00000000143
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1j1tA   PDB: 1j1t   SUPERFAMILY: 1j1tA
Sequence length 233
Comment (A:)
Sequence
DNSNGSTIPSSITSGSIFDLEGDNPNPLVDDSTLVFVPLEAQHITPNGNGWRHEYKVKES
LRVAMTQTYEVFEATVKVEMSDGGKTIISQHHASDTGTISKVYVSDTDESGFNDSVANNG
IFDVYVRLRNTSGNEEKFALGTMTSGETFNLRVVNNYGDVEVTAFGNSFGIPVEDDSQSY
FKFGNYLQSQDPYTLDKCGEAGNSNSFKNCFEDLGITESKVTMTNVTYTRETN
Download sequence
Identical sequences P84143
1j1tA 1j1t_A cath|current|1j1tA00/6-233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]