SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1j20A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1j20A
Domain Number 1 Region: 165-391
Classification Level Classification E-value
Superfamily Argininosuccinate synthetase, C-terminal domain 1.39e-158
Family Argininosuccinate synthetase, C-terminal domain 0.00000199
Further Details:      
 
Domain Number 2 Region: 2-167
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 8.1e-79
Family N-type ATP pyrophosphatases 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1j20A   PDB: 1j20
Sequence length 400
Comment (A:)
Sequence
MKIVLAYSGGLDTSIILKWLKETYRAEVIAFTADIGQGEEVEEAREKALRTGASKAIALD
LKEEFVRDFVFPMMRAGAVYEGYYLLGTSIARPLIAKHLVRIAEEEGAEAIAHGATGKGN
DQVRFELTAYALKPDIKVIAPWREWSFQGRKEMIAYAEAHGIPVPVTQEKPYSMDANLLH
ISYEGGVLEDPWAEPPKGMFRMTQDPEEAPDAPEYVEVEFFEGDPVAVNGERLSPAALLQ
RLNEIGGRHGVGRVDIVENRFVGMKSRGVYETPGGTILYHARRAVESLTLDREVLHQRDM
LSPKYAELVYYGFWYAPEREALQAYFDHVARSVTGVARLKLYKGNVYVVGRKAPKSLYRQ
DLVSFDEAGGYDQKDAEGFIKIQALRLRVRALVEREGHGA
Download sequence
Identical sequences P59846
300852.TTHA0284 WP_011227831.1.52262 YP_143550.1.19876 1j20A 1j1z_A 1j1z_B 1j1z_C 1j1z_D 1j20_A 1j20_B 1j20_C 1j20_D 1j21_A 1j21_B 1j21_C 1j21_D 1kh1_A 1kh1_B 1kh1_C 1kh1_D 1kh2_A 1kh2_B 1kh2_C 1kh2_D 1kh3_A 1kh3_B 1kh3_C 1kh3_D 1kor_A 1kor_B 1kor_C 1kor_D ttk003000039.1 ttk003000039.2 ttk003000039.3 ttk003000039.4 ttk003000039.5 ttk003000039.6 ttk003000039.7 gi|55980253|ref|YP_143550.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]