SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1j3mA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1j3mA
Domain Number 1 Region: 6-128
Classification Level Classification E-value
Superfamily TT1751-like 2.27e-34
Family TT1751-like 0.000000446
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1j3mA   PDB: 1j3m   SUPERFAMILY: 1j3mA
Sequence length 129
Comment (A:)
Sequence
MTGMRKTLKATLAEARAQVEAALKEEGFGILTEIDVAATLKAKLGLEKPPYLILGACNPN
LAARALEALPEIGLLLPCNVVLREAEEGVEVLIQDPKEMFRVLPEATQRALAPVAEEART
RLSRALSRL
Download sequence
Identical sequences Q5SHJ8 Q84BQ8
300852.TTHA1732 1j3mA 1j3m_A 1j3m_B YP_144998.1.19876 ttk003001751.1 cath|current|1j3mA00/3-129 cath|current|1j3mB00/203-329 gi|55981701|ref|YP_144998.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]