SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1j5wA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1j5wA
Domain Number 1 Region: 13-289
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.17e-215
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000000384
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1j5wA   PDB: 1j5w   SUPERFAMILY: 1j5wA
Sequence length 298
Comment (A:)
Sequence
mgsdkihhhhhhmylqdvimklndfwaskgclleqpydmevgagtfhpatffgslrkgpw
kvayvqpsrrptdgrygenpnrlqryfqyqviikpspensqelylesleylginlkehdi
rfvednwesptlgawgvgwevwldgmeitqftyfqqiggislkdipleitygleriamyl
qgvdnvyevqwnenvkygdvflenerefsvfnfeeanvgllfrhfdeyekefyrlveknl
ylpaydyilkcshtfnlldargaisvsqrqtyvkriqamarkaarvflevqanenspa
Download sequence
Identical sequences 1j5w_A 1j5w_B 1j5wA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]